Details for Lyrate rockcress Locus 16063356

Position : sca3 ( 5`- 1607860 .. 1606705 -3` )
Annotation : [B2G] wrky dna-binding protein 39
External links : CoGe
PGDD synteny : 16063356

Protein [Map View]
MEEVEAANRSAVESCHGVLNLLSQQTSDPKSLMVETGEAVSKFKRVASLLTRGLGHGKFRSINKFRSSFPQHIFLESPIC
CGNDLSGDYTQVLAPEPLQMVPASAVYNEMEPKHQLGHPPLMLSHKMCVDKSFLELKPPPFRAPYQLIHNHQQIAYSRSN
SGVNLKFDGSGSSCYTPSVSNGSRSFVSSLSMDASVADYDRNSFHLTGLSCGSDHISQHSRKMCSGSLKCGSRSKCHCSK
KRKLRVKRSIKVPAISNKIADIPPDEYSWRKYGQKPIKGSPHPRGYYKCSSVRGCPARKHVERCIDETSMLIVTYEGEHN
HSRILSSQSAHT*

DNA
ATGGAAGAAGTTGAAGCTGCTAACAGATCAGCTGTAGAAAGCTGTCATGGAGTGTTAAATCTCTTGTCACAACAAACCAG
TGATCCCAAATCCTTAATGGTTGAAACAGGAGAAGCAGTTTCCAAGTTCAAGAGAGTAGCTTCTCTGTTAACTAGAGGGT
TAGGCCATGGAAAGTTTAGGAGTATCAACAAGTTTAGGTCATCTTTTCCTCAACACATCTTCTTAGAGAGCCCTATTTGC
TGTGGTAATGATTTAAGTGGTGATTACACTCAAGTTCTTGCACCAGAGCCACTTCAGATGGTTCCAGCTTCTGCTGTTTA
TAATGAAATGGAGCCAAAACACCAATTGGGTCATCCTCCATTGATGCTTAGTCACAAAATGTGTGTTGACAAGTCGTTTC
TGGAGTTAAAGCCACCGCCTTTTCGTGCTCCTTATCAGTTAATCCACAACCACCAGCAGATAGCTTACTCGAGGAGCAAT
AGCGGTGTAAACCTTAAGTTTGATGGATCTGGTAGTAGTTGCTATACTCCGAGTGTATCAAACGGATCAAGATCATTTGT
GTCATCTCTTAGTATGGATGCTAGTGTAGCAGATTATGATAGGAACTCGTTCCATTTGACCGGATTATCCTGTGGGTCTG
ACCATATATCGCAGCATTCCCGGAAGATGTGCTCTGGTAGTTTGAAATGCGGAAGTAGAAGCAAATGTCATTGTTCCAAG
AAAAGGAAACTGAGGGTAAAACGATCAATCAAGGTGCCTGCAATCAGTAACAAGATTGCAGATATTCCTCCAGATGAGTA
TTCATGGAGGAAGTATGGACAGAAACCGATAAAGGGTTCACCGCATCCACGGGGATACTATAAATGCAGCAGTGTGAGAG
GTTGTCCAGCAAGGAAGCATGTGGAGCGATGTATCGATGAAACTTCAATGTTAATTGTAACTTACGAAGGCGAGCATAAC
CATTCAAGAATATTGTCTTCACAATCAGCTCATACCTGA