Details for Lyrate rockcress Locus 16063343

Position : sca3 ( 5`- 9378321 .. 9375958 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16063343

Protein [Map View]
MAGAGIHPYHQQWPPAGAPPPPAAVSSAAPPHPPPIHHHHPPPPVLVDNHNRPPYDELRTIFIAGLPDDVKERELLNLLR
WLPGYEASQVNFKGEKPMGFALFSTAQYAMAAKDNLQHMVFDAESKSVIHTEMAKKNLFVKRGIVGDSNAYDQSKRLRTG
GDCTHSVYSPSPFHPPPPPVWGPPHGYMAPAPPPYDPYAGYHAPPVPMPAPPPIAAPSSYVPVQNIKDNPPCNTLFIGNL
GENINEEELRSLLSAQPGFKQMKILRQERHTVCFIEFEDVNSATNVHHNLQGAVIPSSGSIGMRIQYSKNPYGKRKEGGG
YSFFPSPSANGAQGALTYQ*

DNA
ATGGCCGGCGCCGGAATCCACCCTTACCATCAGCAGTGGCCGCCGGCAGGTGCGCCACCTCCTCCCGCCGCAGTATCATC
AGCTGCTCCACCACATCCCCCGCCCATTCATCACCATCATCCTCCTCCTCCTGTTTTAGTTGACAACCATAATCGTCCTC
CTTATGACGAGCTTCGGACAATCTTCATCGCAGGGCTTCCTGATGATGTAAAAGAGAGAGAGCTTTTGAATCTCTTAAGA
TGGTTGCCTGGTTACGAGGCTTCTCAGGTGAACTTCAAGGGAGAAAAGCCTATGGGGTTTGCTCTTTTCTCCACGGCTCA
GTATGCAATGGCAGCCAAAGATAACCTTCAGCATATGGTGTTTGATGCTGAGTCAAAGTCTGTGATACATACAGAGATGG
CCAAGAAGAATCTCTTTGTTAAAAGAGGTATTGTTGGGGATTCAAATGCTTATGATCAAAGTAAGCGCCTACGAACTGGT
GGTGACTGCACACACTCTGTGTATAGTCCATCTCCTTTCCACCCTCCACCTCCTCCAGTGTGGGGACCTCCTCATGGGTA
TATGGCACCTGCACCTCCACCATATGATCCCTATGCAGGTTATCATGCTCCACCTGTACCAATGCCTGCGCCCCCACCTA
TAGCAGCTCCAAGTTCATATGTGCCTGTCCAGAATATTAAGGATAATCCCCCTTGCAATACCCTATTTATTGGTAATCTT
GGGGAGAATATAAACGAAGAAGAATTGAGGAGCCTGTTGAGCGCGCAACCTGGTTTCAAACAAATGAAGATTCTGAGACA
AGAAAGGCATACAGTATGCTTTATTGAATTCGAGGATGTCAATAGTGCCACAAATGTTCACCATAATTTGCAAGGTGCTG
TCATTCCAAGTTCTGGTTCAATTGGCATGAGGATCCAATATTCAAAGAATCCATATGGGAAGAGAAAGGAAGGTGGCGGC
TATTCTTTCTTTCCTTCTCCAAGTGCAAATGGAGCCCAAGGAGCTCTGACATATCAGTAG