Details for Lyrate rockcress Locus 16063316

Position : sca3 ( 5`- 2480098 .. 2480857 -3` )
Annotation : [B2G] ATMKK8 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16063316

Protein [Map View]
MVRVRDHRFLNLKLSPIQAPTTIPPCRLPIVAATKASATVSSCASNSFSVANLDRINVLGSGNGGTVFKVKDKTTSEIYA
LKKVKENMDSTSPCREIEILRVVNSPYVVKCHDIFQNPSGEVSILMEYMDLGTLESLSGVSENQLALMARQVLEGLNYLH
EHKIVHRDIKPANLLRSSKEEVKITDFGVSKIVVKSFNKCNSFVGTYAYMSPERLDSEADGVTEEDKSNVYAGDIWSFGL
TMLEILVGYYPML

DNA
ATGGTTAGAGTTAGAGATCATCGATTTCTTAATCTCAAGCTGTCTCCTATACAAGCTCCTACTACTATCCCCCCTTGCCG
CCTCCCCATCGTAGCCGCTACAAAAGCCTCTGCAACAGTTTCTTCCTGCGCAAGCAACAGTTTTTCTGTAGCTAATTTGG
ACAGAATCAATGTTCTAGGCAGTGGAAACGGAGGAACCGTATTCAAAGTTAAAGACAAGACAACCTCAGAGATCTATGCG
TTGAAGAAAGTAAAAGAAAACATGGATTCTACTTCCCCCTGCCGCGAGATCGAAATCCTTCGCGTAGTCAACTCTCCTTA
CGTCGTAAAGTGTCACGACATCTTCCAGAATCCTTCCGGAGAAGTATCTATTCTAATGGAATACATGGATCTTGGTACGC
TCGAGTCTCTAAGCGGTGTTTCAGAGAACCAACTAGCTTTGATGGCTCGTCAGGTTTTGGAAGGGTTAAACTACTTGCAC
GAGCACAAGATCGTACATAGAGATATTAAGCCAGCGAACCTGCTACGTAGCTCGAAAGAAGAAGTCAAAATCACTGACTT
TGGAGTGAGCAAGATCGTGGTCAAGTCTTTCAACAAGTGCAACTCGTTCGTCGGCACGTACGCCTACATGAGTCCTGAGA
GACTCGATAGTGAAGCTGATGGTGTTACAGAAGAAGACAAATCAAACGTTTACGCCGGAGATATATGGAGTTTTGGGCTT
ACGATGCTCGAGATCTTGGTGGGTTACTACCCGATGCTTC