Details for Lyrate rockcress Locus 16063262

Position : sca3 ( 5`- 8921479 .. 8920960 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_479569 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16063262

Protein [Map View]
MLVEMFQLLFTIVSIEAVLILTLGFGTPARRVVVKLLDLSKQGRAPLVAKTVAATMLVLFGSVMFSTIQIHTRVSDSGGV
ANSTDQVMFANCLLEAFLMGTVLFLAMVIDRMHYYTRELQITRRNLEIAVNKGKTGA*

DNA
ATGCTCGTAGAGATGTTTCAGCTTCTATTCACAATCGTGTCAATCGAAGCCGTCCTGATATTAACACTGGGGTTCGGGAC
TCCAGCGAGAAGAGTGGTGGTGAAATTGCTAGACCTATCAAAGCAAGGTCGAGCACCACTGGTTGCGAAAACGGTCGCAG
CCACAATGCTTGTGTTGTTTGGCTCGGTTATGTTCAGCACGATTCAAATACACACAAGGGTATCTGACTCTGGAGGTGTA
GCTAACTCGACCGATCAAGTCATGTTTGCGAATTGCCTCCTCGAAGCTTTCCTCATGGGGACTGTCTTGTTCTTGGCAAT
GGTTATAGACAGAATGCATTATTACACAAGAGAGCTTCAAATCACAAGAAGAAACTTGGAGATTGCTGTAAATAAGGGCA
AAACCGGTGCTTAA