Details for Lyrate rockcress Locus 16063248

Position : sca5 ( 5`- 17832655 .. 17829634 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_486056 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16063248

Protein [Map View]
MTSRFFAQGGSESEDESDYEEEVNEVQNDDVTNRYLQSGSEDELDIDTKRVVKPAKDKRFEEMTHTVEQMKNAMKINDWV
SLQENFDKVNKQLEKVMRITEAVKPPTLYIKTLVMLEDFLNDALANKEAKKKMSTSNSKALNSMKQKLKKNNKLYEDDIN
KYRESPEVEEEKQPEDDDDESDVDDESEDDVEEPTDNLSWEKMLSKKDKLMEKLINKDPKEITWDWVNKKFKEIVASRGK
KGTARFELVDQLTHLTKIAKTPAQKLEILFSVISAQFDVNPGLSGHMPINVWKKCVLNMLTILDILVKYNNIVVDDTVEP
DENETSKPADYDGKIRVWGNLVAFLERIDTEFFKSLQCIDPHTREYVERLRDEPMFLALAQNIQDYFERMGDFKAAAKVA
LRRVEAIYYKPQEVYDAMRKLAELVEEEEEEEETEEAKEESGPPTSFIVVPEVVPRKPTFPESSRAMMDILVSLIYRDGD
ERTKARAMLCDINHHALMDNFGTARDLLLMSHLQDNIQHMDISTQILFNRTMAQLGLCAFRVGMITESHSCLSELYSGQR
VRELLAQGVSQSRYHEKTPEQERMERRRQMPYHMHLNLELLEAVHLICAMLLEVPNMAANSHDAKRRVISKNFRRLLEIS
ERQAFTAPPENVRDHVMAATRALTKGDFQKAFEVLNSLEVWRLLKNRDSILDMVKDRIKEEALRTYLFTYSSSYESLSLD
QLAKMFDVSEPQVHSIVSKMMINEELHASWDQPTQCIVFHEVQHSRLQSLAFQLTEKLSILAESNERAMESRTGGGGLDL
SSRRRDNNQDYAGAASGGGGYWQDKTNYGQGRQGNRSGYGGGRSSGQNGQWLGQNRGGGYAGRVGSGNRGMQMDGSSRMV
SLNRGVRT*

DNA
ATGACGTCTCGTTTTTTCGCTCAGGGTGGAAGTGAAAGTGAAGATGAGAGTGATTATGAAGAAGAGGTTAATGAGGTTCA
AAATGACGACGTCACTAACCGTTACCTTCAAAGTGGTAGTGAGGATGAGTTGGATATCGATACCAAACGTGTGGTTAAGC
CTGCTAAAGATAAACGTTTTGAGGAGATGACCCACACTGTTGAGCAGATGAAGAATGCTATGAAGATCAATGATTGGGTT
AGCCTTCAAGAAAACTTTGATAAGGTTAACAAACAGCTTGAGAAGGTTATGAGGATTACTGAGGCTGTCAAGCCTCCTAC
CTTGTATATCAAGACTCTTGTTATGTTGGAGGATTTCTTGAATGATGCCCTTGCAAATAAGGAAGCCAAGAAGAAGATGA
GCACTAGTAACTCCAAGGCTTTGAACTCTATGAAACAGAAACTGAAGAAGAACAATAAGCTCTACGAAGATGATATCAAC
AAATATCGTGAGTCTCCAGAAGTTGAGGAAGAGAAACAACCTGAAGATGACGACGATGAAAGTGATGTCGATGATGAGTC
TGAAGATGATGTGGAGGAACCTACTGATAATCTCTCTTGGGAGAAGATGCTGAGCAAAAAAGATAAGCTTATGGAGAAGC
TGATTAATAAAGATCCTAAAGAGATCACCTGGGACTGGGTCAACAAGAAGTTCAAGGAAATTGTGGCTTCTCGTGGGAAA
AAGGGCACTGCTCGATTTGAGCTAGTTGATCAGCTTACGCACTTGACAAAGATTGCCAAGACTCCTGCGCAGAAGCTTGA
AATCTTGTTTAGCGTTATTTCAGCTCAGTTTGATGTGAATCCAGGTCTCAGCGGGCACATGCCTATCAATGTCTGGAAGA
AATGCGTGCTTAACATGCTCACCATACTGGACATTCTCGTCAAGTACAATAACATTGTTGTGGATGACACAGTTGAACCT
GATGAGAATGAAACTTCAAAGCCAGCAGATTATGATGGCAAAATTCGGGTCTGGGGAAATTTGGTTGCATTCTTGGAGAG
GATTGACACTGAGTTTTTCAAGAGTTTGCAATGCATTGATCCTCACACCCGTGAGTATGTTGAGAGACTGAGGGATGAGC
CCATGTTCTTGGCCCTTGCTCAGAACATCCAGGACTACTTCGAGCGGATGGGTGATTTTAAAGCTGCTGCAAAGGTAGCC
TTAAGACGAGTTGAGGCAATATATTACAAGCCCCAGGAAGTTTATGATGCTATGAGGAAATTGGCTGAGTTGGTGGAAGA
AGAAGAAGAAGAAGAAGAAACTGAGGAGGCCAAAGAGGAGAGTGGACCTCCTACATCATTCATTGTTGTTCCGGAGGTTG
TTCCCCGAAAGCCTACCTTCCCAGAGAGCAGCCGAGCAATGATGGATATTCTTGTGTCCCTTATCTACAGAGATGGAGAT
GAGCGAACCAAAGCTCGTGCGATGCTATGTGATATCAATCACCATGCTTTAATGGACAACTTTGGGACTGCTAGAGACCT
GTTGCTGATGAGTCATCTGCAAGACAACATCCAGCACATGGACATCTCAACACAGATTCTCTTTAACAGGACCATGGCAC
AGCTTGGTCTTTGCGCCTTCCGGGTTGGAATGATCACTGAGTCCCATAGCTGCCTTTCCGAGCTGTATTCTGGTCAAAGG
GTGAGGGAGTTGCTTGCCCAAGGTGTTTCGCAAAGCCGATACCATGAGAAGACCCCAGAGCAGGAAAGGATGGAGAGGAG
AAGACAAATGCCGTACCACATGCACTTAAACCTCGAGCTCCTGGAGGCAGTTCATCTCATCTGTGCCATGCTACTTGAAG
TCCCAAACATGGCTGCAAACTCGCACGATGCCAAACGCAGAGTGATTAGCAAGAATTTCCGCCGCCTGCTCGAGATCAGT
GAAAGGCAAGCATTCACCGCGCCGCCTGAGAATGTACGTGACCACGTCATGGCAGCCACCAGAGCCCTGACCAAAGGGGA
TTTCCAGAAGGCGTTTGAAGTTTTGAACTCTCTTGAGGTCTGGAGGCTGCTCAAGAACCGTGACAGCATCCTCGATATGG
TGAAGGATAGGATCAAAGAAGAGGCACTAAGGACTTACCTATTCACATACTCAAGCTCCTATGAGTCCTTAAGTCTTGAT
CAGCTGGCCAAAATGTTTGACGTCTCTGAGCCGCAGGTCCACAGCATTGTGAGCAAGATGATGATTAATGAGGAGCTTCA
TGCAAGCTGGGACCAGCCAACTCAATGCATCGTCTTCCATGAAGTGCAACACAGCAGACTACAATCATTGGCTTTCCAGT
TAACCGAGAAACTCTCTATTTTGGCAGAAAGCAATGAAAGGGCAATGGAATCTAGAACCGGTGGAGGTGGTCTGGATCTG
AGCTCAAGGAGAAGGGACAACAATCAAGACTATGCAGGAGCAGCATCAGGTGGTGGTGGATATTGGCAAGACAAGACGAA
TTACGGACAAGGAAGACAGGGTAACAGGTCAGGGTATGGTGGAGGAAGATCATCTGGACAAAATGGTCAGTGGTTAGGGC
AGAACCGAGGAGGAGGGTATGCAGGAAGAGTTGGTTCAGGCAACAGAGGTATGCAGATGGATGGCTCAAGCCGTATGGTG
AGTCTTAACCGAGGTGTTCGTACTTAA