Details for Lyrate rockcress Locus 16063236

Position : sca3 ( 5`- 9160809 .. 9156181 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_318827 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16063236

Protein [Map View]
MAGDDLAETKKGSSKNPKNSNESKLKQKSPAEFFAENKNIAGFDNPGKSLYTTVRELVENALDSAESISELPEVEVTIEE
IVKSKFNSMIGLIDRERVDTQLYDDYETEKAREKRLAKEARASEIQAKNLASGKKNKEPGVSKVLKARGEASYYKVTCKD
NGKGMPHDDIPNMFGRVLSGTKYGLKQTRGKFGLGAKMALIWSKMSTGLPIEISSSMKSQNYVTFCRLDIDIHRNIPHIH
LHEKKGNKEKWHGAEIQVVIEGNWTTYRSKILHYMRQMAVITPYAQFLFRFISETPEKNVTIKFTRRTDVMPPIPIETKH
HPSSVDLLLIKRLITDTSKKTLLQFLQNEFVNINKTLATRLIGEMGPDFGPSMAVKSVTSQQMVRIHQLFRQAKFDDPSG
DCLSPAGEYNLRLGIIKELHPDMVATYSGSFTYFVANLSFVSLSVDFFLETLFSAQVFEGHPFIVEAGVSLGGRDGINIF
RFANRIPLLFEQGADVVTRTALKRINWNSYKINQTQDKIGVFVSIVSTKIPFKGTGKEYIGDDISEIATAVKSAIQQCCI
QLKSKIVKRLQAREQQERKRSLSRYIPDATGAVYEVLKQMTEEHTTKRKRYGEEDTVMLNKVSKHIITKETLKEKLAEHV
EQVDYEMALEYATQSGVSEEPRENIYLQHLDPNKSNFIDLHSPNFVFRLML*

DNA
ATGGCGGGTGATGATTTAGCTGAAACGAAGAAGGGAAGCTCGAAGAACCCTAAGAATAGCAACGAGAGCAAGCTCAAGCA
AAAATCTCCAGCTGAGTTTTTCGCGGAGAACAAGAACATTGCTGGATTTGACAATCCAGGGAAGTCACTTTATACTACAG
TTAGAGAGCTTGTTGAAAATGCTCTTGATTCTGCTGAGTCCATTTCAGAGCTCCCTGAGGTTGAAGTAACAATCGAAGAG
ATTGTAAAATCTAAGTTCAACTCCATGATTGGTCTAATCGATCGGGAACGTGTTGACACACAGCTGTATGATGACTATGA
GACAGAAAAGGCCCGTGAGAAAAGGTTAGCAAAGGAAGCTCGTGCCAGTGAGATCCAAGCTAAAAATTTGGCATCGGGAA
AGAAAAACAAAGAGCCTGGAGTCTCAAAGGTTTTAAAGGCCCGTGGGGAAGCCTCATATTACAAGGTGACATGTAAGGAT
AATGGTAAGGGGATGCCTCATGATGACATTCCAAATATGTTTGGGAGAGTTTTATCCGGGACGAAGTATGGACTGAAGCA
AACACGTGGAAAGTTTGGTCTGGGTGCAAAGATGGCCTTAATTTGGTCCAAAATGAGTACAGGTCTCCCCATAGAGATCT
CGTCATCTATGAAGAGCCAAAACTATGTTACTTTCTGCAGACTGGATATTGATATTCACAGGAACATTCCTCATATTCAT
CTGCACGAAAAGAAGGGCAACAAAGAGAAATGGCATGGGGCTGAAATACAGGTGGTTATCGAAGGAAACTGGACAACATA
CAGATCAAAGATCTTGCATTATATGCGCCAAATGGCTGTCATTACTCCTTATGCGCAGTTTCTGTTTAGATTTATATCAG
AGACACCAGAGAAAAATGTCACTATTAAGTTTACTCGAAGAACTGATGTGATGCCTCCTATTCCTATCGAGACAAAGCAC
CATCCATCGTCAGTTGACTTGCTGCTTATCAAGCGCCTTATTACAGACACTTCCAAAAAGACCCTTCTGCAGTTTCTTCA
AAATGAATTTGTGAATATTAACAAAACCCTTGCAACGCGATTAATTGGGGAAATGGGACCTGATTTCGGCCCTAGCATGG
CTGTCAAATCTGTGACATCTCAGCAAATGGTACGCATACATCAGTTATTCCGCCAAGCTAAATTCGACGACCCTAGTGGT
GATTGTCTTAGCCCAGCAGGAGAATACAATCTTCGTCTAGGGATTATTAAGGAGCTGCATCCAGATATGGTGGCAACGTA
TTCCGGCAGCTTTACCTACTTTGTCGCTAATCTGAGTTTTGTTTCATTAAGTGTTGACTTCTTCCTGGAAACTCTGTTTA
GTGCTCAGGTCTTCGAAGGTCATCCTTTCATTGTTGAAGCTGGTGTTAGTTTGGGTGGAAGAGATGGGATCAACATATTC
CGTTTTGCAAACCGTATTCCTCTCCTTTTTGAACAAGGAGCTGATGTTGTCACCAGGACTGCCTTAAAAAGAATCAATTG
GAATAGTTATAAGATCAACCAGACGCAAGATAAAATAGGAGTATTTGTGAGCATAGTGAGTACAAAAATTCCATTCAAAG
GGACAGGGAAAGAGTACATAGGAGATGACATCAGTGAGATTGCTACTGCAGTCAAGTCTGCAATTCAACAATGCTGCATC
CAACTGAAATCCAAAATTGTCAAGAGACTGCAAGCCCGTGAACAACAAGAGCGAAAACGCAGTTTGAGCAGATACATCCC
CGATGCAACAGGGGCAGTGTACGAGGTTCTGAAACAAATGACAGAAGAACATACAACAAAGAGAAAACGTTACGGAGAGG
AAGACACAGTTATGCTTAACAAAGTATCTAAACATATAATCACAAAAGAAACATTGAAAGAAAAGCTTGCTGAGCATGTA
GAACAGGTGGACTACGAGATGGCATTAGAGTATGCAACACAAAGTGGAGTAAGTGAAGAACCCAGAGAGAATATATATCT
CCAGCACTTAGATCCCAACAAATCCAACTTCATAGATCTTCATAGTCCAAATTTTGTCTTCAGGCTCATGTTGTAA