Details for Lyrate rockcress Locus 16063208

Position : sca3 ( 5`- 7662491 .. 7661599 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16063208

Protein [Map View]
MASLPFGVSNLCRNQEVLSAAVRLHPVGRQTTGFRDAKKVLYRFEGHGLSSSVQVREKQRMRCRVSSNSTETEDDSATKT
KTTPFGYTRKDVILIGVGVTALGIGLESGLEYVGVDPLQAGNAVQLILVLGLTLGWISTYIFRVGNKEMTYAQQLRDYES
QVMQKRLESLSEAELEALMAQVDEEKTKVE*

DNA
ATGGCTTCTTTACCGTTTGGAGTTTCGAATCTATGCAGAAATCAGGAGGTTCTGTCCGCGGCTGTACGGCTTCATCCGGT
TGGGCGACAAACCACAGGATTTAGAGATGCGAAGAAAGTCTTATATAGATTCGAGGGACATGGATTGTCATCATCAGTAC
AAGTGAGAGAGAAACAAAGAATGAGATGTAGAGTTAGCTCAAACTCTACTGAAACTGAAGACGATTCTGCCACAAAGACC
AAGACGACGCCGTTTGGTTACACGAGGAAGGATGTTATACTGATAGGAGTGGGAGTGACTGCACTTGGTATCGGCCTAGA
GAGTGGACTTGAGTATGTGGGAGTAGATCCGTTGCAAGCAGGGAACGCTGTGCAGCTGATACTGGTGCTGGGTTTGACTT
TGGGTTGGATTTCGACTTATATCTTTAGAGTCGGTAACAAGGAGATGACTTATGCCCAGCAACTTCGTGACTACGAGTCT
CAAGTCATGCAGAAACGACTGGAGAGCTTATCAGAGGCAGAGTTAGAGGCATTGATGGCACAGGTTGATGAAGAGAAGAC
CAAGGTTGAGTAG