Details for Lyrate rockcress Locus 16063188

Position : sca3 ( 5`- 8972129 .. 8970194 -3` )
Annotation : [B2G] tetraacyldisaccharide 4 -kinase family protein
External links : CoGe
PGDD synteny : 16063188

Protein [Map View]
MEKLRKVVNEIAYTRVHTTSPALHRSLVPILTLASSLYSGALQIRRSLYRFSLLQKDRLPVPVISVGNLSWGGNGKTPMV
EYISQLLVDSGISPLILTRGYAGGDEAKMLERHLRGGPVKIGVGANRAATAALFLEKYGCVDPSTLRTFFDLHERAEART
ISQKIGSIILDDGMQHLSLSRDLEIVMLNGLNPWGNGHLVPLGPLREPLVALERADIAVVHHVDLITKQSLRDIENMVQG
FKKSIPIFYSKMVPNYLFEVKNARSHVALEALRCASVLCVSAIGSADAFVKSIEMTGAHYVDRLDFSDHHLFEAQDVETM
RRRANGLEHKSNSKPIIVVTEKDYDRDPEILKCLDSYTVLVLCSELQITPIRGTDVDSFNSTLMRALAAKFYVYS*

DNA
ATGGAGAAGCTGAGGAAGGTGGTGAACGAAATCGCCTACACGCGAGTCCATACTACTTCCCCTGCTCTTCACCGCTCTCT
CGTTCCCATCCTCACACTCGCTTCTTCTCTATACTCCGGCGCTCTCCAAATCCGCCGCTCTCTCTACCGCTTCTCACTCT
TGCAGAAAGACCGATTACCGGTTCCGGTGATCAGCGTTGGGAATTTAAGCTGGGGAGGTAATGGGAAGACGCCAATGGTG
GAATACATTTCTCAACTCCTCGTTGATTCTGGAATTTCACCTCTTATTCTCACTCGTGGTTATGCTGGTGGAGATGAAGC
CAAAATGCTTGAAAGACATCTTCGTGGTGGACCGGTAAAGATTGGTGTTGGTGCAAACCGGGCAGCTACTGCTGCTCTGT
TTTTGGAAAAGTATGGTTGTGTAGATCCTTCTACTTTAAGGACATTCTTTGATCTTCATGAAAGAGCAGAAGCCAGGACC
ATTTCTCAAAAAATTGGTTCTATCATTCTAGATGATGGGATGCAGCATTTGAGTTTGTCTCGTGATCTCGAGATTGTGAT
GCTTAACGGGCTGAATCCGTGGGGAAATGGTCATTTGGTTCCCCTTGGTCCTTTACGAGAACCTCTTGTGGCGCTTGAGC
GGGCAGATATTGCTGTAGTCCACCACGTGGACTTGATTACTAAACAAAGCCTCAGAGATATTGAGAACATGGTCCAAGGA
TTCAAAAAGTCGATCCCGATTTTCTACTCCAAGATGGTGCCCAATTACTTGTTCGAAGTTAAAAATGCTAGGTCACATGT
AGCTTTAGAAGCATTGCGCTGTGCCTCTGTGCTATGTGTTTCCGCAATTGGATCTGCTGACGCATTCGTCAAGAGCATCG
AGATGACTGGAGCACATTATGTTGATAGACTTGATTTCAGTGATCATCATTTATTTGAAGCACAGGATGTCGAAACTATG
AGGAGGAGAGCAAATGGACTAGAGCACAAATCTAATTCCAAGCCTATCATTGTAGTAACTGAAAAGGATTATGATAGAGA
CCCCGAGATCCTCAAATGTCTGGACTCATACACAGTCTTAGTGCTATGCTCTGAGTTGCAAATAACTCCTATTAGGGGAA
CTGATGTGGATAGCTTTAATTCTACACTTATGAGAGCTCTAGCTGCTAAGTTTTATGTTTACAGTTAG