Details for Lyrate rockcress Locus 16063181

Position : sca3 ( 5`- 4008018 .. 4005379 -3` )
Annotation : [B2G] aspartate glutamate uridylate kinase family protein
External links : CoGe
PGDD synteny : 16063181

Protein [Map View]
MASCDDDFSLLGDDQSNPNQHHHHHQVLHHTPYAPRRFNPKPSNQIHLPHHQRNGDEDDENDVVVEASSAFHGVGVNPFA
GDENSNPYDDNNAGVDEDEDLDANRSRIGGVRVEKRQSQEELSDGGTTNGGETTPYGSFKRPRTSSSSAGEYRKDREEWS
DAAIACLLDTYSDKFTQLNRGNLRGRDWEEVASSVSERCEKLSKSVEQCKNKIDNLKKRYKLERHRMTSGGTSASHWPWF
KKMEDIVGNSLATKGASDEDRSGSSMGNTVKPARRYPLVTYNPGVQINNVKSKATSNPRWRRVVLKISGAALACTGPNNI
DPKVINLIAREVAMACRLGVEVAIVVGSRNFFCGSTWITATGLDRTTAYHISMMASVMNSALLQSSLEKIGVQARLQTAI
SVQGVGEPYNRQRATRHLDKGRVVIFGGIGATLGNPLLSSDASAALRAIDINAEAVVKGTNVDGVYDCHSQDSNVTFEHI
SFQDLASRGLTSMDTMALNFCEENSIPAVVVFNFLEAGNITKALCGEQVGTMIDRSGRGVS*

DNA
ATGGCGTCGTGTGATGACGATTTCTCTCTACTTGGAGACGATCAGTCAAACCCTAATCAACATCACCACCACCACCAAGT
TCTTCATCACACGCCCTACGCTCCTAGACGATTCAACCCGAAACCATCGAATCAGATCCATTTACCGCATCACCAGAGGA
ACGGTGACGAGGACGACGAGAACGATGTCGTTGTAGAGGCGTCTTCTGCTTTTCACGGTGTTGGTGTTAATCCTTTCGCT
GGTGACGAAAATTCGAATCCATATGATGATAATAACGCAGGTGTCGACGAAGACGAAGATCTCGATGCCAACAGATCCAG
AATCGGAGGTGTTCGTGTTGAGAAGAGACAGAGTCAGGAGGAGCTAAGTGACGGAGGAACAACGAATGGTGGTGAGACCA
CACCTTACGGTAGCTTCAAGAGGCCGAGGACATCGTCTTCCTCAGCTGGTGAGTATAGGAAAGATAGGGAAGAGTGGAGC
GATGCGGCGATCGCGTGTTTGTTAGATACGTATTCGGATAAGTTCACACAGCTTAACCGAGGGAATCTGCGGGGAAGAGA
TTGGGAAGAGGTTGCTTCATCGGTGAGTGAGAGGTGTGAAAAGCTGAGTAAGAGTGTAGAACAGTGTAAGAACAAGATTG
ATAATCTCAAGAAGAGGTATAAGCTTGAAAGGCATAGGATGACCAGTGGTGGAACATCAGCTAGTCACTGGCCTTGGTTT
AAGAAGATGGAAGATATTGTTGGCAATTCCTTGGCAACGAAAGGCGCGTCTGATGAAGATAGAAGCGGAAGCTCAATGGG
GAATACTGTGAAGCCAGCGAGGAGGTATCCCCTGGTAACATATAACCCTGGAGTTCAGATTAATAACGTCAAATCCAAGG
CCACATCAAACCCAAGATGGCGAAGAGTGGTTTTGAAAATCAGTGGTGCAGCTCTTGCCTGCACGGGTCCCAATAACATT
GATCCAAAGGTAATCAATCTGATTGCAAGAGAAGTTGCGATGGCTTGTCGTCTTGGTGTTGAGGTAGCGATAGTTGTTGG
GAGTCGGAACTTTTTTTGTGGCAGCACATGGATAACTGCCACTGGTTTGGATAGAACCACTGCATATCATATCAGTATGA
TGGCATCTGTGATGAACTCTGCTTTACTCCAATCATCCCTGGAGAAAATAGGGGTTCAGGCACGGTTACAAACTGCAATA
TCGGTTCAGGGTGTCGGGGAGCCTTACAATCGTCAACGAGCCACCCGGCATCTAGATAAGGGAAGAGTAGTAATATTTGG
TGGAATCGGTGCAACGCTTGGAAATCCACTCTTATCATCTGATGCATCTGCAGCCCTTCGAGCTATAGACATCAATGCGG
AGGCAGTGGTGAAAGGAACAAACGTTGATGGTGTTTATGACTGCCATTCACAAGATAGTAACGTGACATTTGAGCACATA
TCATTTCAAGATTTGGCTTCTAGAGGTCTTACGTCAATGGATACAATGGCCCTTAACTTCTGTGAAGAGAACAGCATCCC
AGCAGTTGTGGTATTTAACTTTCTGGAAGCTGGGAACATCACAAAAGCGTTATGCGGAGAACAAGTGGGTACTATGATCG
ATAGAAGTGGAAGGGGTGTGAGTTAG