Details for Lyrate rockcress Locus 16063157

Position : sca3 ( 5`- 3364440 .. 3363516 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16063157

Protein [Map View]
MERREDHYSNYFVQSPSSLSHDLEFEFQSPTRSDSAPLVLSPVNEFPKHSDFLRNSGNKLVYEDDEKMLVPLRRSSNSGW
WIVLQIGWRFFFSLGVALLVFYIGLTFSACFPFGIGRFNQFMLEEGVDSHGASTKFLTFNCSTKLIVDNKSNVFGLHIHP
PSIKFFFGPLNFAKAQGPKLYALSHESTTFQLYIGTTNRAMYGAGAEMDDMLQSRAGLPLILRTSIISDYRVVWIT*

DNA
ATGGAGAGAAGAGAGGACCACTACTCAAACTACTTCGTCCAAAGCCCTTCATCGCTATCCCACGACCTCGAGTTCGAATT
CCAGTCTCCCACTCGATCTGACTCAGCGCCATTGGTCCTATCCCCCGTCAATGAATTCCCCAAGCACTCAGATTTCTTGA
GAAACTCCGGAAACAAATTAGTGTATGAGGATGATGAGAAAATGTTGGTGCCATTGCGTCGTAGCTCCAATTCGGGTTGG
TGGATCGTTCTGCAAATAGGTTGGAGGTTTTTCTTTAGCTTAGGAGTGGCATTGCTTGTCTTCTACATTGGTTTAACCTT
TTCGGCCTGTTTTCCTTTTGGGATTGGAAGGTTTAATCAGTTTATGTTAGAAGAAGGTGTGGATTCACATGGAGCGTCGA
CTAAGTTCCTCACTTTCAATTGCTCTACCAAGCTCATAGTAGATAACAAGTCTAATGTCTTTGGCCTTCACATTCATCCT
CCATCTATCAAATTCTTCTTTGGCCCCCTCAACTTTGCAAAGGCGCAAGGACCTAAACTATATGCGTTGAGCCATGAGTC
GACAACATTTCAGCTCTACATAGGAACAACGAACCGGGCAATGTATGGGGCAGGAGCGGAGATGGATGATATGCTTCAGT
CGAGAGCTGGATTGCCTCTAATACTGCGGACAAGCATAATTTCCGACTATCGAGTTGTCTGGATTACCTAA