Details for Lyrate rockcress Locus 16063031

Position : sca2 ( 5`- 15921239 .. 15921730 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_476499 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16063031

Protein [Map View]
MANTNPESANKSTTPSTDMELKKVFDQFDSNGDGKISVSELGNVFKSMGTSYTEEELNRVLDEIDIDRDGFINQEEFATI
CRSSSSASEIREAFDLYDQNKNGLISSSEIHKVLNRLGMSCSVDDCVRMIGHVDADGDGNVNFEEFQKMMSSPELVKGSV
ANT*

DNA
ATGGCAAACACAAATCCTGAATCCGCTAACAAATCCACAACGCCATCAACGGATATGGAGCTAAAGAAAGTCTTCGACCA
ATTCGACTCCAACGGCGACGGGAAAATCTCTGTTTCAGAGCTCGGAAACGTTTTCAAATCCATGGGAACGTCCTACACGG
AGGAGGAGCTAAACCGTGTATTAGACGAAATCGACATCGATCGTGACGGTTTCATCAATCAGGAAGAGTTCGCTACCATT
TGCCGATCATCTTCCTCCGCATCAGAGATACGTGAAGCGTTCGATCTCTACGATCAGAACAAAAACGGTTTGATATCGTC
CTCTGAGATCCATAAGGTTCTGAATCGTCTTGGTATGTCTTGCTCTGTTGACGATTGTGTGAGAATGATCGGTCATGTTG
ATGCTGATGGCGATGGAAATGTTAACTTCGAGGAGTTTCAGAAGATGATGTCGTCTCCTGAGCTCGTTAAGGGATCGGTC
GCAAACACTTAG