Details for Lyrate rockcress Locus 16062987

Position : sca3 ( 5`- 1360018 .. 1358464 -3` )
Annotation : [B2G] SIP1_1 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16062987

Protein [Map View]
MMGVVKSAIGDMLMTFSWVVLSATFGIQTAAIISAGDFQGITWAPLVILTSLIFVYVSIFTVIFGSASFNPTGNAAFYVA
GIPGDTLFSLAIRLPAQAAGAAGGALAIMEFIPEKYKHMIGGPSLQVDVHTGAIAETILSFGITFAVLLIILRGPRRLLA
KTFLLALATISFVVAGSKYTGPAMNPAIAFGWAYMYSSHNTWDHIYVYWISSFVGALSAALLFRSIFPPARPQKKKQKKA
*

DNA
ATGATGGGTGTGGTGAAGTCGGCGATTGGGGATATGTTGATGACCTTCTCTTGGGTTGTCCTCTCCGCGACTTTTGGAAT
CCAGACGGCGGCGATTATCTCCGCCGGCGATTTTCAGGGAATCACTTGGGCTCCGTTGGTGATCTTGACGTCGTTGATTT
TCGTCTACGTCTCGATCTTCACCGTTATCTTCGGTAGCGCTAGCTTCAATCCTACCGGAAACGCCGCCTTTTATGTCGCC
GGTATCCCCGGAGATACTCTTTTCTCCTTGGCGATTAGATTACCCGCTCAGGCAGCTGGTGCGGCAGGAGGTGCATTGGC
CATCATGGAGTTCATACCAGAGAAATATAAGCATATGATTGGAGGACCTTCTCTTCAGGTTGATGTGCACACTGGAGCTA
TTGCAGAAACGATCTTAAGTTTTGGTATTACCTTTGCGGTTTTGCTGATTATCCTCAGGGGTCCACGGAGATTACTCGCT
AAGACATTCTTGCTTGCTCTTGCAACCATCTCATTTGTTGTCGCCGGGTCTAAATACACTGGACCAGCCATGAATCCTGC
CATTGCATTTGGGTGGGCATACATGTACAGCTCCCACAACACATGGGACCATATCTATGTCTACTGGATCAGTTCTTTCG
TAGGAGCATTATCTGCTGCATTGCTCTTCCGTTCTATCTTCCCTCCAGCTCGGCCACAGAAGAAGAAACAAAAGAAAGCC
TGA