Details for Lyrate rockcress Locus 16062978

Position : sca2 ( 5`- 16506875 .. 16507814 -3` )
Annotation : [B2G] gns1 sur4 membrane family protein
External links : CoGe
PGDD synteny : 16062978

Protein [Map View]
MTLNYYLAEHPTIVNFRWSPTQSYASTWSFLFTAVSSYVIAAVTLHLLLLIILSLCHRRRGFSLGPIPALHSLTISIVSA
VIFVGILLSAAAEIRDTRWLWRRTRTTALQWFLCFPVGTRASGRVFFWSYAFYLSRFLHLFRTFFSVIRRRKLSFFQLIN
QSSLLCISFLWLEYSQSFQVVAILLTTVSYAVVYGYRFWTEIGLRGACFPFVVNCQAILLGCMTVCHVGVLCIHLVKRGG
CNGIGAWLFNSVLNAVITLLYLKFYCKTRSMMMTKAVHTTT*

DNA
ATGACTCTGAATTACTATCTAGCGGAGCATCCAACGATCGTTAACTTCCGTTGGAGTCCAACCCAATCCTACGCCTCCAC
GTGGTCTTTCCTCTTCACCGCCGTCTCATCTTACGTCATCGCCGCCGTCACTCTCCACCTCCTCCTCCTCATAATCCTCT
CCCTCTGTCACCGCCGCCGCGGATTCTCCCTCGGTCCAATCCCAGCTCTACACAGCTTAACCATTTCCATAGTCTCCGCC
GTCATCTTCGTCGGAATCCTCCTCTCCGCCGCAGCAGAGATCAGAGACACGCGCTGGCTATGGCGTCGCACACGCACCAC
GGCTCTCCAATGGTTCCTCTGTTTTCCCGTAGGTACACGCGCTTCGGGGCGCGTGTTCTTCTGGTCATACGCGTTTTACC
TCTCAAGATTTCTTCACTTGTTCCGTACTTTCTTCTCCGTGATACGACGTCGTAAGCTCAGCTTCTTTCAGCTCATTAAC
CAGTCTTCTCTTCTCTGTATCTCCTTCCTCTGGCTCGAATATTCCCAATCCTTTCAGGTAGTAGCGATACTGTTAACGAC
CGTTTCGTACGCCGTTGTATACGGTTACAGATTCTGGACGGAGATTGGGTTACGTGGCGCGTGTTTTCCGTTTGTCGTTA
ACTGTCAAGCAATTCTGTTAGGGTGCATGACGGTTTGCCACGTAGGCGTACTCTGTATACACCTGGTCAAACGCGGCGGT
TGTAACGGTATCGGTGCTTGGTTGTTTAACTCTGTTCTTAACGCCGTTATCACGTTGCTCTACTTGAAGTTTTATTGCAA
GACGCGTTCAATGATGATGACCAAGGCTGTTCACACCACCACATAA