Details for Lyrate rockcress Locus 16062961

Position : sca3 ( 5`- 2841668 .. 2842276 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16062961

Protein [Map View]
MEFSLIADTVTVCTAKQGIAFGKSLLQRLDLANHISFADSVVDNQSPGGGIVQASAIIFPVDAIAPPPVRSSSYKTIRRI
RKKRRTRRVSFGGDGDDGGDFGRFLLEGDFGGNDGPFGFGGGGNDGGGKGWNYGGGGGGGFGRDNWDGSSFSSWSDPAME
FVYEVICWIALSNCVHFAFKRIVRIVTDGEREKLDITLSPVC*

DNA
ATGGAGTTCTCTTTGATCGCCGACACAGTCACAGTTTGCACGGCTAAGCAAGGTATCGCGTTTGGGAAATCTCTTCTTCA
AAGGTTGGATTTGGCCAATCACATTTCTTTCGCCGATTCTGTTGTTGATAATCAATCTCCCGGTGGAGGAATCGTTCAAG
CATCGGCGATTATCTTTCCCGTTGATGCAATTGCTCCTCCACCTGTCAGATCTAGCTCTTATAAGACAATTCGCCGGATC
CGCAAAAAGCGACGAACCAGGCGAGTTTCGTTTGGCGGTGATGGAGACGACGGAGGAGATTTTGGTCGTTTTCTGTTAGA
AGGTGATTTCGGTGGTAACGACGGTCCATTCGGATTTGGAGGCGGAGGAAACGATGGAGGTGGAAAGGGATGGAACTACG
GCGGCGGCGGTGGTGGTGGTTTCGGGAGGGATAATTGGGATGGGTCTTCGTTTTCGTCTTGGTCAGATCCAGCAATGGAA
TTCGTGTACGAAGTGATCTGCTGGATCGCGTTGTCTAATTGTGTGCACTTTGCGTTCAAGAGGATAGTGAGGATTGTGAC
CGACGGTGAAAGGGAGAAGTTGGACATTACATTATCTCCGGTGTGCTGA