Details for Lyrate rockcress Locus 16062946

Position : sca3 ( 5`- 4954125 .. 4949348 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_478590 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16062946

Protein [Map View]
MEEVQPPVTPPIDPNGKRSEASLLDICEKVLSLDGSTCDEALKLFTETKRILSASMSNIGSGTREEVERFWFAFILYSVK
RLSVRKEADGQSVSGDNGFNLCQILRALKLNIVDFFRELPQFVIKAGSVLGELYGADWENRLQAKELQANFVHLSLLSKY
YKRGFHEFFLTYDANAEKNSANSSTYLADSYRFGWLLFLALRNHAFSRFKDLVTCSNGVVSILAILIIHVPCRFRNFSIQ
DSSRFVNKGDKGVDLVASLCKIYDASEDELRIVIDKANNLVETILKKKPSPASDCQTDKLDNIDPDGLTYFEDLLEEMSI
SSSLIMLEKDYDDGKGELDERVFINEEDSLLGSGSLSAGAVNITGVKRKIDALSSPARTLISPLSPHKSPAAKTNGISGA
TKLAATPVSTAMTTAKWLRTVICPLLPKPSPGLEHFLKSCDRDITNDVTRRAHIILEAIFPNSSLGAQCGGGSLQAVDLM
DDIWAEQRRLEALKLYYRVLEAMCKAEAQILHANNLNSLLTNERFHRCMLACSAELVLATHKTITMLFPAVLERTGITAF
DLSKVIESFIRHEDSLPRELRRHLNSLEERLLESMVWEKGSSMYNSLIVARPSLALEINQLGLLAEPMPSLDAIAALINF
SEGVNHASSIQKHETCSGQNGGIRSPKRLCTDYRSILVERNSFTSPVKDRLLALGNVKSKMLPPPLQSAFASPTRPNPGG
GGETCAETGINIFFTKINKLAAVRINGMVERLQLSQQIRESVYCFFQHVLAQRTSLLFSRHIDQIILCCFYGVSKISQMS
LTFREIIYNYRKQPQCKPLVFRSVYVDSLQCRRQGRIGPDHVDIITFYNEIFIPAVKPLLVELGPVRNDRAVEANNKPEG
QCPGSPKVSVFPSVPDMSPKKVSAVHNVYVSPLRGSKMDALISHSTKSYYACVGESTHAYQSPSKDLSAINNRLNNSSSN
RKRTLNFDVEAGLVSDSMVANSLNLQNQNQNQNVSDGLSSGAAPLKTEPTDS*

DNA
ATGGAAGAGGTTCAGCCTCCAGTGACCCCGCCCATTGACCCAAATGGGAAAAGAAGCGAAGCGTCTCTTTTGGACATATG
CGAGAAAGTTCTGTCTCTTGATGGGAGCACTTGCGATGAAGCTTTGAAGTTGTTTACAGAAACCAAACGAATTTTGTCAG
CAAGCATGTCTAACATTGGAAGTGGAACGCGGGAGGAAGTAGAGAGGTTCTGGTTTGCCTTTATTCTCTATTCAGTGAAG
AGGCTTAGTGTGAGAAAAGAAGCGGATGGTCAGTCAGTGTCTGGTGATAATGGGTTTAATCTATGTCAGATTCTGAGGGC
TCTGAAGCTAAATATTGTGGATTTTTTTAGAGAGTTACCTCAGTTTGTGATCAAGGCTGGATCTGTACTAGGTGAACTTT
ATGGCGCAGACTGGGAGAATAGACTTCAGGCAAAGGAGTTGCAGGCTAACTTTGTGCATCTTAGCCTTCTAAGCAAATAC
TACAAACGTGGGTTCCACGAATTCTTCTTGACATATGATGCAAACGCAGAAAAGAATTCAGCAAACTCTTCTACCTATTT
GGCGGATAGTTATCGTTTTGGATGGCTACTCTTTTTGGCACTCCGAAACCATGCGTTTAGTCGATTTAAGGACCTCGTGA
CTTGCTCAAATGGCGTAGTTTCTATATTGGCTATTTTAATCATACATGTTCCTTGTCGGTTTAGAAATTTCAGCATCCAA
GATTCTTCTCGCTTTGTTAATAAAGGTGACAAAGGTGTAGACTTGGTTGCATCACTTTGCAAGATATATGACGCCTCTGA
AGATGAGTTGAGGATAGTAATTGACAAGGCAAATAATTTGGTAGAAACCATATTGAAGAAAAAGCCATCTCCAGCATCTG
ATTGCCAAACTGACAAGCTAGATAATATTGACCCAGATGGCTTGACCTACTTTGAGGATTTACTGGAGGAGATGTCCATC
TCATCTAGCTTGATTATGCTAGAAAAGGATTACGACGATGGTAAAGGCGAACTCGATGAGAGGGTATTCATCAATGAAGA
GGATAGCTTGCTTGGATCTGGAAGCTTATCTGCTGGAGCTGTAAATATTACTGGTGTCAAGAGGAAAATTGATGCTTTGA
GCTCACCTGCAAGGACATTGATAAGCCCACTTTCTCCTCATAAGTCACCTGCTGCTAAGACAAATGGTATTAGCGGTGCT
ACCAAGTTGGCAGCAACACCAGTGAGCACAGCAATGACAACTGCCAAGTGGCTCAGGACTGTCATATGCCCGCTTCTGCC
AAAACCTTCTCCTGGATTGGAACATTTCCTTAAATCATGTGACAGGGATATAACAAATGACGTCACACGAAGAGCTCACA
TAATATTGGAAGCTATTTTTCCAAATAGTTCCCTTGGTGCCCAATGTGGAGGTGGAAGTTTGCAAGCTGTTGACCTGATG
GATGACATATGGGCAGAGCAGCGGAGATTAGAAGCTCTCAAGTTATACTACAGAGTTCTTGAGGCAATGTGTAAAGCAGA
AGCTCAGATTTTGCATGCAAATAATCTGAACTCTTTATTGACAAATGAGAGGTTCCATAGATGCATGCTTGCTTGCTCAG
CTGAATTGGTACTGGCTACCCACAAAACAATTACAATGTTGTTCCCAGCTGTTCTGGAGAGGACTGGGATCACAGCCTTT
GATCTCAGCAAGGTAATAGAGAGTTTCATCAGACATGAGGACTCTCTACCTAGAGAGTTGAGACGACATCTGAATTCACT
GGAGGAACGGCTTCTAGAGAGTATGGTATGGGAGAAAGGCTCTTCAATGTACAATTCTCTGATTGTTGCCAGGCCATCGC
TTGCATTGGAGATAAATCAGCTCGGATTACTAGCTGAACCGATGCCATCTCTGGATGCAATTGCAGCACTTATTAACTTC
TCTGAAGGAGTAAATCATGCATCATCTATTCAAAAGCATGAAACTTGTTCAGGACAAAATGGGGGGATAAGATCGCCCAA
AAGGTTATGTACTGATTACCGCAGTATTCTAGTTGAACGCAATTCCTTTACATCACCAGTAAAGGATCGTCTCTTGGCCT
TAGGCAACGTTAAATCCAAGATGCTGCCACCTCCGTTGCAGTCTGCATTTGCCAGCCCAACACGGCCCAACCCAGGAGGC
GGAGGAGAAACTTGTGCAGAAACTGGAATCAATATTTTCTTCACCAAGATTAATAAATTGGCTGCTGTCAGAATCAATGG
AATGGTGGAAAGGCTACAACTTTCGCAGCAAATAAGGGAGAGTGTATATTGTTTCTTCCAACATGTACTTGCTCAGCGGA
CTTCTCTTTTATTCAGTCGTCACATTGACCAGATCATTCTCTGTTGCTTCTACGGAGTGTCCAAGATATCCCAAATGAGC
CTGACTTTCAGGGAAATCATATACAACTACCGGAAGCAACCACAGTGTAAACCATTAGTTTTCCGCAGCGTTTATGTGGA
TTCGTTACAATGTCGCCGTCAAGGGAGAATAGGGCCAGATCATGTTGACATCATCACATTCTACAATGAGATATTTATTC
CTGCCGTAAAGCCGTTGCTGGTGGAGCTAGGTCCTGTGAGAAACGACCGGGCTGTGGAAGCCAATAATAAGCCTGAAGGT
CAATGTCCCGGATCGCCAAAGGTGTCTGTGTTTCCAAGTGTTCCAGACATGTCCCCTAAAAAAGTATCTGCTGTGCACAA
TGTTTATGTGTCTCCTCTTCGGGGATCAAAGATGGATGCTCTTATTTCACACAGTACGAAGAGTTACTATGCTTGTGTTG
GAGAGAGTACACATGCTTACCAGAGCCCTTCAAAGGACCTATCTGCCATCAACAACCGCTTGAACAACAGCAGCAGCAAC
CGCAAGAGGACGCTGAACTTTGATGTAGAAGCAGGGCTGGTCAGCGATTCCATGGTAGCAAATAGCCTTAACCTCCAAAA
CCAAAATCAAAACCAAAATGTAAGCGATGGATTGTCCTCAGGTGCCGCACCCCTTAAAACCGAGCCAACAGATTCATAG