Details for Lyrate rockcress Locus 16062919

Position : sca1 ( 5`- 29118312 .. 29116357 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_314742 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16062919

Protein [Map View]
MAILSASSTIVRAALDTQPKLRYNPNAPRNVKNLSSFVPPLSPSSSSPATNLTTGTNVSVSDLLKRPASKDVGNGFDDNC
IGYDKWFPSPPKVEKPRSVFNAASLAYIGDSIYEQGYQVMIILFFRMQGCQMRIIFSDYSIKTATMSLCYFLYLSLAVLG
YKNIYARRHFLFPPLSIEEYNDRVRAVVRCEAQYALLQKLVDDDFLTKDERDVLRWGKNVGSAKTRSTRRAGVAVYNKAS
SLETLIGYLYLSNGKRLEEMMQKLGFSSGSSTERMIKEAGKNKPSFK*

DNA
ATGGCGATTCTATCAGCGAGCTCTACTATCGTGAGAGCTGCTTTAGATACGCAGCCGAAGCTCCGATACAATCCCAATGC
GCCGCGAAATGTCAAGAATTTAAGCTCTTTCGTTCCACCGTTGTCTCCGTCTTCATCTTCTCCGGCGACAAACTTGACAA
CAGGAACAAACGTCTCCGTTTCTGATTTGCTTAAACGTCCCGCAAGCAAAGATGTTGGTAATGGATTTGATGATAATTGT
ATTGGATATGATAAATGGTTTCCAAGTCCACCAAAAGTGGAGAAACCTAGATCTGTCTTCAATGCTGCCTCATTAGCTTA
TATTGGCGATTCAATCTATGAGCAAGGATATCAAGTGATGATTATCTTGTTCTTTAGGATGCAAGGATGTCAAATGAGGA
TCATTTTTAGTGATTATAGCATTAAGACAGCCACTATGAGTTTGTGCTACTTTTTGTACTTAAGCCTTGCTGTTTTAGGA
TACAAGAATATATATGCTCGTCGGCATTTTCTTTTTCCTCCACTTAGTATTGAAGAATATAATGACCGTGTTAGAGCAGT
GGTGCGATGTGAAGCACAATATGCTTTGCTGCAGAAGCTTGTTGATGATGATTTCTTAACAAAAGATGAAAGGGATGTAC
TTCGGTGGGGAAAAAATGTAGGCTCGGCTAAAACACGGTCAACTAGGCGTGCTGGTGTTGCTGTTTATAACAAGGCCTCA
TCATTGGAAACACTAATTGGGTATTTGTATCTATCAAACGGGAAAAGATTGGAAGAAATGATGCAGAAGCTAGGATTCTC
AAGTGGTTCTTCAACAGAGAGAATGATTAAGGAAGCTGGCAAGAATAAACCATCTTTCAAATAA