Details for Lyrate rockcress Locus 16062913

Position : sca3 ( 5`- 2539343 .. 2541909 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_477933 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16062913

Protein [Map View]
MKMQDSAAQQPEIAIIVGDSSSSSSQVDHQVKEKSTEDVPSSQSIETHLDLSIQIPLRPIPFGNGRNPKSSLKSTSSFKS
GSTSSPRGILRNLSLKKKVISQPESERSSLLSPGLMETAKKPNAAGSTASPYWKRCLSLPNRHAAKLSPVVSTQVSAGVP
GEPRNKDYPRSLSMPGRNKVIVRSISFDNHKARVSSETSADQISSVPPEETDEEIPEEEAVCRICLDVCEEGNTLKMECS
CKGDLRLVHEACAMKWFSTKGTRTCDVCRQEVKNLPVTLVRVPTSNQPNNRRDRSQPNMPSQTVSAWQEFVVLVLISTVC
YFFFLEQLLIRDLNKQAIYIAAPFSLTLGLLASIFAIVLAIREYIWTYAALEFALVGMLVHILYATVRLSATYSILFAGI
LGFGIAVCLNSLYLHYFAWRVRIAENSSPV*

DNA
ATGAAGATGCAAGATTCGGCAGCTCAACAACCGGAAATTGCTATAATCGTGGGAGATTCTTCTTCTTCTTCTTCTCAGGT
TGATCATCAGGTAAAAGAAAAATCTACTGAAGATGTGCCGAGCTCTCAATCTATCGAAACCCACTTGGATCTTTCAATAC
AAATACCTCTCAGACCAATTCCATTCGGTAACGGTCGTAACCCAAAGAGTTCATTGAAGTCCACTAGTTCATTCAAAAGT
GGCAGTACATCCTCACCAAGAGGAATCTTGCGCAATTTAAGCTTGAAAAAGAAAGTTATTTCTCAACCCGAAAGCGAGAG
AAGCTCCCTACTATCTCCCGGTCTCATGGAAACCGCTAAAAAGCCTAATGCTGCTGGTTCCACAGCTTCGCCTTATTGGA
AAAGATGCTTATCGCTTCCTAATAGACATGCTGCAAAATTGTCTCCGGTTGTATCTACACAAGTTTCAGCTGGGGTGCCT
GGTGAGCCGCGTAATAAAGATTATCCAAGGTCCTTGTCCATGCCCGGAAGAAACAAAGTGATTGTGCGATCCATATCTTT
TGACAACCACAAAGCCCGTGTTTCCAGTGAAACAAGTGCAGATCAAATCTCTTCCGTTCCTCCTGAAGAAACTGATGAAG
AAATTCCCGAAGAAGAAGCCGTGTGCAGGATCTGTCTGGATGTGTGCGAAGAGGGCAATACTTTGAAAATGGAGTGCAGC
TGCAAAGGTGATCTCAGACTTGTTCATGAAGCGTGTGCCATGAAATGGTTTAGTACAAAGGGAACAAGAACCTGTGACGT
CTGTAGACAAGAAGTAAAGAACTTACCAGTTACATTGGTTCGTGTGCCCACAAGTAATCAACCAAACAACAGACGTGATC
GCAGTCAACCAAATATGCCGTCACAAACCGTAAGTGCTTGGCAAGAGTTTGTGGTGCTAGTTCTAATCAGCACAGTCTGC
TACTTCTTCTTCCTCGAGCAATTACTGATTCGTGACTTGAACAAGCAAGCTATTTACATCGCGGCGCCATTTTCACTTAC
GTTAGGCCTCTTAGCATCCATTTTTGCCATTGTCCTCGCTATCAGAGAATACATATGGACATACGCAGCACTCGAGTTTG
CGCTTGTGGGCATGTTGGTTCATATATTATATGCTACAGTTAGACTATCGGCGACCTATTCTATACTTTTTGCAGGGATT
CTTGGTTTTGGGATAGCCGTGTGCCTAAACTCGTTGTACCTTCATTATTTCGCTTGGCGTGTACGCATTGCAGAAAATTC
AAGTCCTGTATGA