Details for Lyrate rockcress Locus 16062910

Position : sca3 ( 5`- 8326884 .. 8328804 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_479444 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16062910

Protein [Map View]
MGTHINFNNLGGGGHPGGEGSSNQMKPTGSVVMPLARQSSVYSLTFDELQNTLGGPGKDFGSMNMDELLKSIWTAEEAQG
LAMTSSSAATAVAQPGTGIPGGNLQRQGSLTLPRTISQKTVDEVWKCLITKDGNMGSSSGGGGESNALPGRQQTLGEMTL
EEFLFRAGVVREDNCAQQMGQVNGNNNNNGFYGNSTAAGGFGFGFDQPNQNSISFNGNNDSIIMNQPPGLGLKVGGTMLQ
QQQQQQLLQQQQQQQLQQLNQPHPQQRLPQIIFPKQTNVAFSSPVNIVNKGFAGAANNSINNSNGLASFGGTGVTVAATS
PGTSSAENNSLSPVPYVLNRGRRSNTGLEKVIERRQRRMIKNRESAARSRARKQAYTLELEAEIEKLKKTNQELQKKQAE
MVEMQKNELKESSKQPWGSKRQCLRRTLTGPW*

DNA
ATGGGAACTCACATCAATTTCAACAACTTAGGAGGTGGTGGTCACCCTGGAGGGGAAGGGAGTAGTAATCAGATGAAGCC
AACGGGTAGTGTTGTCATGCCCTTGGCGAGGCAGTCCTCGGTCTATTCCCTTACCTTTGATGAGTTACAGAACACACTAG
GTGGACCGGGAAAAGATTTCGGGTCAATGAACATGGATGAACTCCTGAAGAGCATATGGACTGCTGAGGAAGCTCAGGGC
CTGGCCATGACTTCTTCGTCAGCTGCTACAGCGGTAGCGCAACCCGGTACTGGTATCCCTGGTGGGAACCTCCAGAGGCA
AGGCTCTTTGACGTTGCCTAGAACGATTAGTCAGAAGACTGTTGATGAGGTGTGGAAATGTTTGATCACCAAGGATGGTA
ATATGGGAAGTAGCAGCGGAGGCGGTGGTGAGTCGAATGCGCTTCCTGGGAGGCAACAGACTTTAGGGGAAATGACACTT
GAAGAGTTTCTGTTCCGTGCTGGGGTTGTAAGAGAAGATAACTGTGCTCAACAGATGGGTCAGGTCAATGGAAACAACAA
CAACAACGGGTTTTATGGTAACAGCACCGCTGCTGGCGGCTTTGGTTTTGGATTTGATCAGCCAAATCAAAACAGCATAT
CATTCAATGGTAATAATGATTCTATTATCATGAATCAGCCACCTGGTTTAGGGCTCAAAGTGGGTGGAACAATGCTGCAG
CAGCAGCAGCAACAACAGTTATTGCAGCAGCAGCAACAACAGCAGTTGCAGCAGCTGAATCAGCCTCATCCACAGCAGCG
GCTGCCTCAAATCATTTTTCCTAAACAAACAAATGTAGCATTTTCTTCGCCTGTGAATATAGTCAACAAGGGTTTTGCTG
GGGCTGCAAATAATTCCATCAACAATAGTAATGGATTAGCTAGTTTCGGAGGAACTGGGGTTACTGTTGCAGCAACTTCT
CCAGGGACAAGCAGCGCAGAAAATAATTCTTTATCACCAGTTCCATATGTGCTTAATCGAGGACGAAGAAGCAATACAGG
TCTAGAGAAGGTTATCGAGAGGAGGCAAAGGAGAATGATCAAGAACCGAGAATCAGCTGCTAGATCAAGAGCTCGAAAGC
AGGCTTATACATTGGAACTGGAAGCTGAAATTGAAAAGCTCAAGAAAACGAATCAAGAACTGCAGAAAAAACAGGCTGAA
ATGGTGGAGATGCAGAAGAATGAGCTGAAGGAATCGTCGAAGCAACCGTGGGGCAGCAAAAGACAATGCTTGAGAAGGAC
ATTAACTGGTCCGTGGTGA