Details for Lyrate rockcress Locus 16062888

Position : sca3 ( 5`- 445150 .. 443954 -3` )
Annotation : [B2G] 40s ribosomal protein s19
External links : CoGe
PGDD synteny : 16062888

Protein [Map View]
MAGKTVKDVSPHDFVKAYASHLKRSGKIELPTWTDIVKTGKLKELAPYDPDWYYIRAASMARKVYLRGGLGVGAFRRIYG
GSKRNGSRPPHFCKSSGGIARHILQQLETMNIVELDTKGGRRITSSGQRDLDQVAGRIAVEP*

DNA
ATGGCAGGTAAAACTGTGAAAGACGTCTCTCCTCATGACTTCGTCAAGGCTTATGCTTCTCATCTCAAGCGATCTGGCAA
GATCGAGCTTCCCACATGGACAGACATTGTGAAGACCGGAAAGTTGAAGGAGCTTGCACCATATGACCCTGATTGGTACT
ACATCAGAGCTGCATCTATGGCTAGGAAGGTTTACCTTAGGGGAGGACTTGGTGTTGGTGCTTTCCGTAGAATCTATGGT
GGCAGCAAGAGGAACGGTAGTCGCCCACCTCACTTTTGCAAAAGCAGCGGTGGGATTGCCCGTCATATCCTCCAGCAGTT
GGAGACAATGAACATTGTTGAGCTCGACACCAAAGGAGGAAGAAGAATCACTTCCAGTGGCCAACGGGATTTGGACCAGG
TTGCTGGCCGTATTGCAGTTGAACCTTGA