Details for Lyrate rockcress Locus 16062855

Position : sca3 ( 5`- 11985183 .. 11983512 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16062855

Protein [Map View]
MSKDAPEVATHNKRRKKEASSSSSSRFLHSLPEAVAISCLACVSRLDHAALSLVSKTCRSMVLSSELYQTRSLTGYAEKF
LYVCFCMPTDETPRLFIFRPTKDAAIRNNVNLAHGAHPIPSFPSQQRKGSSVVALDRGIYVIVGWVNGNRLSRVLLFVCR
FHKWHHVTSMRVPRVSPEVRVVDGKIYVWGSCMYKHYSNWGEPVVEEKIYVVNSWDDGSFYYLPSQSKWETGNQDSKRSK
DWCLIDKLIYSYGNDGGIYWCEAGELDWCDAVKIDWREVLGLEFLSMALRESRVVHFGGKMVKVWESYKIMYNISKNLEE
LLPETILTNLINLGKNVLVFWEKLERGGDYMSMEIWCVRRFRWKSGKEARFGAGVIGAILSSQSIFSRLILSSATLRSCI
LSLLTFENLDFLVL*

DNA
ATGTCCAAAGACGCTCCCGAAGTGGCAACACATAATAAGAGGAGGAAGAAAGAGGCATCTTCGTCGTCATCGTCAAGGTT
TCTACATTCTTTGCCAGAAGCGGTGGCTATAAGTTGCTTAGCCTGCGTATCAAGATTGGACCATGCAGCCTTATCTCTCG
TCTCCAAGACCTGCCGGTCAATGGTTCTTTCGTCCGAGCTCTACCAGACACGATCGTTGACGGGTTACGCTGAGAAATTC
CTCTATGTATGCTTCTGCATGCCTACTGACGAAACTCCTCGTTTGTTCATCTTCCGCCCAACTAAAGATGCTGCCATCAG
GAACAATGTGAATCTAGCTCACGGTGCTCACCCGATCCCCTCGTTCCCCAGTCAACAACGGAAAGGATCTTCCGTGGTGG
CGTTGGATAGGGGGATCTATGTCATCGTTGGATGGGTTAATGGCAATCGCTTGTCCCGTGTCTTGCTGTTCGTTTGTCGG
TTTCACAAGTGGCACCACGTGACTTCCATGAGAGTGCCTCGTGTTTCCCCCGAGGTCCGCGTGGTGGATGGAAAGATATA
CGTGTGGGGAAGCTGCATGTACAAACATTACTCCAACTGGGGAGAACCAGTGGTGGAGGAGAAGATTTACGTGGTGAATT
CATGGGATGATGGAAGCTTTTACTACTTGCCGAGCCAGAGTAAATGGGAAACAGGGAATCAAGATTCAAAGCGTAGCAAG
GATTGGTGTCTAATAGATAAGTTGATATACAGTTATGGTAACGACGGGGGTATATATTGGTGTGAGGCAGGGGAGTTAGA
TTGGTGTGATGCAGTGAAGATTGATTGGAGGGAGGTGTTGGGTTTGGAGTTTTTGTCAATGGCGCTCCGTGAATCGAGAG
TGGTACACTTTGGTGGGAAAATGGTAAAAGTGTGGGAGTCCTATAAGATCATGTACAATATCAGCAAAAACCTTGAAGAA
TTACTTCCCGAGACCATATTGACCAACTTGATCAACCTTGGTAAGAATGTTTTGGTCTTTTGGGAAAAGCTCGAACGTGG
TGGTGATTACATGAGCATGGAGATTTGGTGTGTGCGGAGATTTCGTTGGAAAAGTGGGAAGGAGGCCAGATTTGGGGCAG
GTGTGATTGGTGCCATCCTATCCTCGCAATCGATCTTCTCACGGTTGATCCTCTCTTCTGCCACTTTAAGGTCTTGTATT
CTATCCCTGTTGACGTTTGAAAACTTGGATTTTCTTGTACTTTAA