Details for Lyrate rockcress Locus 16062845

Position : sca3 ( 5`- 1386281 .. 1383633 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16062845

Protein [Map View]
MDRPPSFPHYQHPNPNFFHHVPPPNPNPNIFFRPPPPHLQNPNNYSIAPPSPPPIHELSGTLTSLQSLLSECQRTLDSLS
QNLALDHSSLLQKDENGGFVRCPFDSNHLMPPEALFLHSLRCPNPLDLTHILGSFSCYRNTLELPCELQLNNNGDLCVSL
DDLADFGRNFFYRDCPGAVNFSELDGKKPTLTLPNVLSVECNDFVVSDEKEKGSMLDKWLGILPSDLCAIKSEINQWRDF
PSSYSYSVLSSIVGSKAIATSDLRTWILVKSTRYGVIIDTFMRDHVFLLFRLCLKSAVKEACRLIESDANAVGEKQIMSC
KSRTFECPVLIQVLSWLASQLAVLYGEGNGKYFALDMFKQCIVESAFRVMLFQSEGTRPKCSGVLEDLDDASLSNKDVKM
VKPFENSSGGEGGKTLDSPQVISVSRVAAAVAALYERSLLEGKIRAVRYAQPLTRYQRAAELGVMTAKADEERNRRCSYR
PIIDHDGLPRQRSSTQDMNKMKTREELLAEERDYKRRRMSYRGKKVKRTPRQVLHDIIEEYTEEIKLAGGIGCFEKGMPL
QSPSPIGSDQKESDFGYNTAPPYKQWKGENRAAIEYPMDDRNNSDKVKRHVEYDSGSSQRQQSHRSYKHGDRRDDKHSDR
RDDKFTRSERHSLERKSYHRNHRSSREKSSSDCKTKRDDPYDRCSREPRNQNSFEDRYIPTERE*

DNA
ATGGATCGACCACCGTCGTTTCCTCACTATCAACACCCTAATCCGAACTTCTTCCACCACGTTCCTCCTCCAAATCCTAA
TCCTAATATCTTCTTCCGACCTCCTCCACCTCATCTTCAAAATCCTAACAATTACTCCATCGCTCCTCCGTCTCCGCCGC
CGATTCACGAGCTCTCCGGTACACTCACTTCTTTACAATCCCTGTTGTCGGAATGTCAAAGAACCTTAGATTCTCTCTCG
CAAAATCTAGCTTTAGACCACTCTTCGCTTCTCCAGAAGGACGAAAATGGCGGTTTCGTTCGTTGCCCTTTCGATTCAAA
TCACTTAATGCCACCTGAAGCTCTCTTTCTTCATTCACTTCGTTGCCCAAATCCTCTTGACCTCACTCATATTCTTGGAT
CCTTTAGTTGTTACCGGAACACGCTCGAGTTACCATGTGAACTACAGTTGAATAATAACGGTGATCTCTGTGTCTCTTTA
GATGACTTGGCTGATTTTGGGAGAAATTTCTTCTACAGAGATTGTCCAGGAGCTGTTAACTTCTCTGAGCTCGATGGTAA
AAAGCCAACTTTAACACTTCCTAATGTTCTATCTGTGGAATGCAACGATTTTGTAGTTTCTGATGAGAAGGAGAAAGGTA
GTATGTTGGATAAATGGTTAGGGATTTTACCGTCTGATCTCTGTGCAATAAAGAGTGAGATTAATCAATGGAGGGATTTC
CCAAGTTCGTATTCCTATAGTGTTCTTTCTTCGATTGTGGGTTCAAAAGCGATTGCAACGAGCGACTTGAGGACATGGAT
TCTGGTTAAGTCGACGAGATATGGTGTTATAATCGATACATTCATGAGGGATCATGTATTCTTGCTCTTTCGGTTGTGTC
TCAAATCGGCTGTGAAAGAAGCTTGTAGATTGATAGAGTCTGATGCTAATGCTGTTGGTGAGAAGCAGATTATGAGCTGC
AAAAGTAGAACATTTGAGTGTCCAGTCTTGATTCAAGTGTTGTCTTGGTTAGCTTCTCAACTTGCTGTCTTGTATGGAGA
AGGAAATGGCAAGTATTTTGCTTTGGACATGTTTAAACAGTGCATAGTAGAATCTGCCTTTCGGGTAATGTTGTTTCAGT
CAGAAGGAACAAGACCTAAATGCTCTGGAGTTCTCGAGGATTTGGATGATGCAAGCTTGAGTAATAAGGATGTGAAGATG
GTGAAGCCCTTTGAAAATAGTTCAGGTGGGGAAGGTGGCAAAACTTTGGACAGTCCACAGGTGATTTCTGTGTCTCGTGT
TGCAGCAGCTGTTGCAGCTTTGTATGAAAGATCCTTGCTTGAAGGAAAAATAAGGGCAGTTCGATATGCCCAACCACTAA
CGAGATATCAGCGGGCGGCTGAGCTTGGTGTTATGACAGCTAAAGCTGATGAGGAACGGAATAGACGTTGTAGCTACCGA
CCTATTATTGATCATGATGGTCTTCCGAGACAACGCTCATCAACTCAGGATATGAATAAAATGAAGACAAGGGAAGAGCT
TTTAGCAGAAGAGAGAGATTATAAGCGTCGGAGAATGTCATACCGTGGAAAGAAGGTGAAACGAACGCCTCGACAGGTGT
TACATGATATAATAGAAGAATATACAGAAGAAATTAAGTTAGCAGGAGGTATTGGGTGTTTTGAGAAAGGAATGCCATTA
CAATCCCCGTCTCCTATAGGCAGCGATCAGAAAGAAAGTGACTTTGGATACAATACTGCACCACCATATAAGCAATGGAA
AGGAGAGAACCGTGCAGCTATTGAATATCCAATGGATGACAGAAACAATTCAGATAAAGTAAAGCGGCATGTTGAGTATG
ATTCAGGTAGCTCGCAGAGACAACAGAGTCACAGATCATATAAGCACGGTGATCGAAGAGATGACAAGCACAGTGATCGT
AGAGATGACAAATTCACAAGGAGCGAACGACATAGCCTTGAAAGGAAATCTTATCATCGAAACCACAGATCATCTCGTGA
GAAGAGTTCTTCAGATTGTAAGACCAAAAGGGATGATCCTTATGACCGCTGCAGTCGGGAACCTAGAAATCAAAATTCTT
TTGAAGATAGATACATACCAACAGAAAGGGAGTGA