Details for Lyrate rockcress Locus 16062830

Position : sca3 ( 5`- 2164121 .. 2167525 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_477858 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16062830

Protein [Map View]
MGKRNTFWARNSNSKVRSKDKGSDESDEDYVISDEDEEESEADLKEEYASSVDGFDGSDAVEAEELDEVEEEDVMLRNVE
WPKVKTGPRGNRKITGCKSRKMNQVVSDNEDVDLDDADDEEEEIRNSRKAVGKVGSLDGEKHSRIGLGKRRRVFYEIEDE
DGDYPEEDGEEEEERDVENVDLNSLHDGEDGMMALEEQDNVSHETEKEDDGDYEDEDGDEDFTADEDVSLDEEEEEETIA
CNKKSLKVCNKNKRKRRSGEGRKRRKKCSVAKTRSTRGRKRHGKNTNRGVDEDDDDFVDDCLPARKKAKTKSSRPRRRRT
VPSDSDIASSAESDYEYTISEEEREQIIEAGSLLRSSVKHASSIRQTTVNKDLPQLRKPPVKKGEKKVKLVKREVIKNVC
GICLSEEDMRRLKGTLDCCSHYFCFTCIMEWSKVESRCPLCKQRFRTISKPARSTPGVDLREVVITVPERDQVYQPTEEE
LRSYLDPYENIICTECHQGDDDGLMLLCDLCDSSAHTYCVGLGREVPEGNWYCEGCRPVALGSASSQTHNTSEQQRVSGF
YSRPSPLVVSGQYQDASLLVSPRTPFFNGENLFSPRLPNGDVQGSSPSGLGATTLSSRRTLHRHIQNIINSDRLINMGAR
TGGTSSDGFVTTQVGHGRTIDPSQPAANQVTGVSLYTISDERLPDNNSLISAHNPELLSPKLDEFGSQEAFRRLSNNTFL
GERPIDLGLCHGLAQGDPLFGNQQHLHSYMPNTMSSMAGERLPQRVKAHLKNLSSQIDLGQTTFDEISTCSMHTILAACG
LEHESSEVHLVPPPVTCTHHHMIPGSSSSSSSSSLMKGCCYSCFDSFVEDVVKMILDTRQPHWLRLGLH*

DNA
ATGGGAAAGAGAAACACTTTTTGGGCTAGAAATTCTAATAGCAAGGTTAGATCTAAGGATAAGGGTTCTGATGAATCTGA
TGAGGATTATGTGATTTCCGACGAGGATGAAGAAGAGTCTGAGGCTGATCTCAAGGAGGAGTATGCCTCATCCGTTGACG
GTTTTGATGGGTCTGATGCAGTGGAAGCTGAGGAGTTAGATGAGGTGGAAGAGGAAGATGTGATGCTGAGGAATGTTGAG
TGGCCAAAAGTGAAAACTGGTCCTCGTGGTAACCGGAAAATCACGGGATGTAAGTCAAGAAAGATGAACCAAGTTGTGTC
TGACAACGAGGATGTGGATCTTGATGATGCGGATGATGAAGAGGAGGAGATAAGGAATTCAAGGAAGGCTGTTGGAAAAG
TTGGGTCTTTGGATGGAGAGAAACACAGTAGAATAGGTTTAGGAAAGCGAAGGAGAGTTTTCTATGAGATAGAGGATGAA
GATGGAGACTATCCAGAGGAGGATGGCGAGGAAGAGGAAGAGAGGGATGTGGAAAATGTGGATTTAAATTCTTTGCATGA
TGGTGAAGACGGGATGATGGCATTGGAAGAGCAGGACAATGTGTCACACGAGACAGAAAAGGAAGATGATGGAGATTATG
AGGATGAGGATGGCGATGAAGATTTTACCGCAGATGAAGATGTCTCATTAGATGAGGAAGAGGAGGAAGAAACAATTGCA
TGTAACAAAAAGTCACTGAAGGTTTGTAATAAAAACAAGCGAAAGCGAAGATCTGGAGAAGGTCGTAAAAGAAGGAAGAA
ATGCTCTGTTGCAAAAACCCGTTCAACGAGGGGAAGAAAGAGACATGGGAAAAACACAAACAGAGGAGTTGATGAAGATG
ATGATGATTTTGTAGATGACTGCCTACCTGCAAGAAAGAAGGCGAAGACAAAGTCATCAAGGCCAAGGCGTCGGCGTACC
GTGCCATCAGATTCAGACATTGCATCCTCTGCAGAATCCGATTATGAATACACAATCTCGGAGGAGGAACGAGAGCAGAT
AATAGAAGCTGGTAGTTTGTTGAGAAGTAGTGTGAAGCATGCATCATCTATAAGACAAACCACAGTCAATAAGGATTTGC
CTCAGCTTCGTAAACCTCCTGTGAAGAAAGGTGAAAAGAAGGTAAAGCTAGTGAAAAGAGAGGTGATAAAAAACGTTTGT
GGGATTTGTCTGTCTGAGGAAGACATGCGGAGATTGAAGGGAACATTGGACTGCTGTAGCCATTACTTTTGTTTCACTTG
CATAATGGAGTGGTCAAAAGTAGAATCTCGCTGCCCGCTCTGCAAGCAGCGGTTCAGAACAATCAGTAAGCCTGCAAGAT
CTACACCTGGAGTAGATTTGAGAGAAGTTGTGATAACTGTACCTGAACGTGATCAGGTCTATCAACCTACTGAAGAAGAG
TTGAGGAGTTATCTCGATCCCTATGAAAATATAATATGCACTGAATGTCACCAAGGTGATGATGATGGGCTTATGTTGCT
TTGTGATCTTTGTGATTCATCTGCCCATACGTACTGTGTTGGTCTCGGGAGGGAAGTACCTGAAGGAAACTGGTACTGTG
AAGGTTGTAGACCCGTTGCACTTGGATCAGCTAGTTCCCAAACGCATAATACATCCGAGCAACAAAGGGTTAGTGGCTTT
TACAGTAGACCATCACCTCTTGTAGTTTCAGGGCAATATCAAGATGCGTCTTTGCTAGTCTCCCCACGTACACCATTTTT
CAATGGAGAGAACCTATTTTCTCCAAGGCTTCCTAATGGTGATGTTCAAGGTTCTTCTCCATCCGGCTTAGGGGCAACCA
CATTATCAAGTAGAAGGACGCTTCACAGACACATACAAAATATTATCAACAGTGATAGACTTATTAATATGGGTGCTAGA
ACTGGTGGAACATCGAGTGATGGTTTTGTGACTACACAAGTAGGTCATGGCAGAACAATCGACCCGTCTCAGCCTGCAGC
GAACCAAGTAACAGGTGTGTCATTGTATACAATCTCTGATGAAAGACTACCCGACAACAATTCATTGATTTCTGCCCATA
ACCCTGAGCTTTTGTCTCCAAAGTTAGATGAATTTGGAAGCCAAGAAGCATTCAGACGTTTGTCTAATAATACATTTCTT
GGTGAGCGGCCTATCGATTTAGGATTATGTCATGGGCTGGCTCAGGGTGATCCCTTGTTTGGTAATCAACAACATCTTCA
CAGCTACATGCCAAACACAATGTCTTCCATGGCAGGAGAACGACTGCCACAAAGAGTTAAAGCGCATCTCAAAAACTTGT
CCAGTCAAATCGACTTAGGTCAAACCACTTTCGACGAAATTTCCACGTGCTCAATGCACACGATACTGGCAGCTTGTGGA
CTTGAACACGAGAGCAGTGAAGTCCATCTTGTTCCGCCACCAGTGACGTGTACTCACCATCATATGATACCTGGCAGCAG
TAGTAGTAGTAGCAGCAGCAGCCTAATGAAAGGGTGTTGCTATTCTTGTTTTGATTCATTTGTAGAAGATGTAGTTAAAA
TGATTCTAGACACAAGACAACCCCATTGGTTGAGGCTAGGGCTCCACTAA