Details for Lyrate rockcress Locus 16062825

Position : sca3 ( 5`- 5450030 .. 5450914 -3` )
Annotation : [B2G] zinc finger family protein
External links : CoGe
PGDD synteny : 16062825

Protein [Map View]
MEDATETRYWCHMCSRSVVPLIQDQIINCNFCQSGFVEQMDNDDQDSDHQAADSLWAPILMEMMNNHDQQHSTNQEDEDD
GDQNNDGEIDITRQLEEIRRIRTRHSTAIVNLLQGIRAGLLIESETNDDNPDNSELVILINSFNQRIRVHQDSVDTASVP
SGSLGDYFIGPGFETLLQRLAENDLNNRYGTPPATKEAVEALAMVKIEESLLQCSVCLDDFEIGMEAKEMPCKHKFHSDC
LLPWLELHSSCPVCRYLLPTADDDEPKKDADTSRNDDTNGDISDASMASNSLVN*

DNA
ATGGAAGATGCAACAGAGACTAGGTACTGGTGTCACATGTGCTCTCGATCGGTGGTTCCATTGATTCAAGACCAAATCAT
CAATTGCAATTTCTGTCAAAGTGGATTCGTTGAACAAATGGATAATGATGATCAAGATTCGGATCATCAGGCTGCTGATT
CTCTCTGGGCTCCTATCTTGATGGAGATGATGAACAATCATGACCAACAACATTCAACGAATCAGGAAGACGAAGATGAT
GGTGATCAGAACAATGATGGAGAAATTGATATTACTCGGCAACTTGAAGAGATTAGGAGGATAAGGACTAGACATTCAAC
TGCCATTGTTAATCTGCTTCAAGGGATTCGAGCTGGCTTATTGATCGAATCCGAGACCAATGATGATAATCCCGATAATA
GCGAGCTTGTCATCTTGATCAACTCCTTTAACCAAAGGATCAGGGTTCATCAAGATTCTGTCGACACGGCTTCTGTTCCT
TCTGGATCTTTGGGTGACTATTTCATTGGACCTGGATTCGAGACGTTACTTCAGCGTTTGGCTGAGAATGATCTGAACAA
CCGGTATGGGACACCTCCAGCTACAAAAGAAGCGGTTGAGGCCTTGGCCATGGTGAAAATCGAAGAGAGTTTGTTGCAAT
GTAGTGTCTGTTTGGATGATTTTGAGATTGGAATGGAGGCTAAAGAGATGCCTTGTAAGCATAAGTTTCATAGTGACTGC
TTGTTGCCATGGCTTGAGCTTCATAGCTCATGCCCTGTTTGCAGATATCTGCTTCCTACAGCAGATGATGATGAGCCGAA
GAAGGATGCAGACACATCGAGAAACGATGATACCAATGGCGATATCAGTGATGCTTCTATGGCGAGCAATTCATTGGTTA
ACTAG