Details for Lyrate rockcress Locus 16062809

Position : sca3 ( 5`- 827647 .. 826348 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16062809

Protein [Map View]
MASSSSSSLSVTIFLLLAPLCLSRESPSQIPNGTLDLSLLWYGQFTPIQKERVQDFIESLNFDAKEGLDPKVSAWWKVVE
SYQERFEVKDIYRQKKSNRTVAPRIKVKVVRSYVDEKMKYGKELTIGNAEKLVETAIGNMSKVVPVVLLSAQVRAIGVGF
CNGTCQHNALAKIKGQNEPRPYIMVSNPEDECPGECAWPFHTADKGPRGMTYQPPSGEVGADALVIQLATGLADLATNPT
LTEFLFKSETTPYNDDGKRNHVSSIYIADPATKCTRVFGSGAFPGFTGRIRVDPVTGGAFNSHGINHLKFLIPSIWDPKT
KSCWTPM*

DNA
ATGGCGTCTTCTTCCTCCTCCTCCTTATCCGTCACCATTTTCCTCCTCTTGGCGCCTCTCTGCCTTTCACGTGAGTCACC
TTCGCAAATCCCAAACGGAACCCTAGATCTCTCTTTACTATGGTACGGCCAATTCACGCCTATTCAAAAGGAGAGGGTTC
AAGATTTCATAGAATCGCTTAACTTCGACGCCAAGGAAGGTCTTGACCCAAAGGTATCGGCCTGGTGGAAAGTGGTGGAG
AGTTACCAAGAGAGGTTCGAGGTGAAGGATATTTACCGACAGAAGAAGAGTAACAGAACCGTAGCTCCGAGGATTAAGGT
CAAGGTTGTCCGGAGTTATGTGGATGAGAAGATGAAGTATGGAAAGGAATTGACAATCGGAAATGCTGAGAAACTTGTTG
AGACGGCCATCGGAAATATGTCGAAAGTGGTGCCCGTTGTATTACTTTCGGCGCAAGTTAGGGCTATTGGCGTAGGGTTT
TGTAACGGAACTTGCCAACATAACGCCCTTGCCAAAATTAAAGGTCAAAATGAACCGCGACCGTACATAATGGTAAGCAA
CCCGGAGGATGAATGTCCCGGAGAGTGCGCTTGGCCTTTCCACACGGCCGACAAGGGTCCACGTGGCATGACCTATCAAC
CGCCAAGTGGCGAAGTTGGAGCCGACGCATTGGTTATTCAGCTAGCCACCGGTTTAGCCGATCTCGCCACCAATCCAACT
CTAACCGAGTTCTTATTCAAATCTGAGACGACACCGTACAACGATGACGGAAAGAGAAACCATGTTTCTTCCATCTATAT
CGCGGACCCTGCAACCAAATGCACTCGGGTTTTTGGATCCGGAGCTTTCCCAGGTTTCACCGGTAGAATTCGGGTTGACC
CGGTAACCGGTGGAGCCTTTAATTCACACGGAATCAACCACTTGAAATTCTTGATTCCTTCTATTTGGGACCCTAAGACC
AAATCTTGCTGGACTCCTATGTAA