Details for Lyrate rockcress Locus 16062772

Position : sca3 ( 5`- 7250949 .. 7253180 -3` )
Annotation : [B2G] ubiquitin-conjugating enzyme 31
External links : CoGe
PGDD synteny : 16062772

Protein [Map View]
MADERYNRKNPAVKRILQEVKEMQANPSDDFMSLPLEENIFEWQFAIRGPGDTEFEGGIYHGRIQLPADYPFKPPSFMLL
TPNGRFETNTKICLSISNYHPEHWQPSWSVRTALVALIAFMPTSPNGALGSVDYPKEERRTLAIKSRETPPKYGSPERQK
IIDEIHHYILSKATIVPNPLPLECNQTSSTISEAHSQAEPQESITVVEEQSISTTETIVDDQIIEETAEAVNTVANVVPA
AAALTAVEVAAKASVSGEQTMARRTAQKPVDDRLFTWAAVGLIIAIVVLLLKKFIRSTGYGAGFMDQS*

DNA
ATGGCGGATGAGAGGTATAACCGGAAGAATCCGGCGGTGAAGAGGATTTTGCAGGAGGTTAAGGAGATGCAAGCAAATCC
CTCTGATGATTTTATGTCTCTTCCTCTTGAGGAGAATATCTTTGAGTGGCAATTCGCCATCCGAGGTCCAGGTGACACTG
AATTCGAGGGCGGGATTTATCATGGGAGAATTCAGCTGCCTGCAGATTACCCTTTCAAACCTCCTTCATTCATGTTATTG
ACCCCTAATGGTCGCTTTGAAACCAATACCAAGATTTGCTTGAGCATTTCAAATTACCACCCTGAGCATTGGCAACCTTC
ATGGAGTGTTCGGACTGCTTTGGTGGCTCTGATTGCATTCATGCCAACAAGTCCTAATGGAGCACTGGGCTCAGTAGATT
ATCCAAAGGAGGAGAGACGTACACTAGCCATTAAATCTCGTGAGACACCACCCAAGTATGGCTCTCCTGAACGGCAAAAA
ATTATTGATGAGATTCATCACTACATCCTTAGCAAAGCAACCATTGTTCCAAACCCTCTTCCTCTGGAATGTAACCAAAC
ATCTTCCACCATATCAGAGGCTCACTCCCAAGCTGAGCCACAGGAATCCATAACAGTAGTGGAGGAGCAGTCCATCTCTA
CAACAGAAACCATAGTTGATGATCAAATCATAGAAGAGACAGCTGAAGCAGTCAATACAGTAGCTAATGTGGTTCCCGCT
GCAGCAGCGTTAACAGCAGTTGAGGTTGCAGCCAAAGCTTCTGTAAGTGGTGAGCAAACGATGGCCAGAAGAACGGCACA
GAAGCCCGTCGATGACAGACTCTTCACGTGGGCGGCGGTTGGGCTCATAATCGCTATCGTAGTTCTTCTTCTGAAGAAGT
TCATAAGATCAACTGGTTATGGTGCTGGGTTTATGGATCAGTCTTGA