Details for Lyrate rockcress Locus 16062734

Position : sca2 ( 5`- 16470780 .. 16469448 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16062734

Protein [Map View]
MVLVFFGNIFVKAHLTSMGKRVFVGISIIMMTSIYAVSSSHSPSLEKQISNSPRDQYSLPEDLLVEISSCVAASSLSEIS
NLRLVSKSFKRISNDRYVLRRLSLNEIPLFPWFRNRGKFHNFIKRCRKNGNPEAIYRKGLVDYFHRNSSKRQRDKGLKHI
AKVANKGNQEAQYVYGLILICLGGETKQKGFKILSSLRKPLMSSTLEEMEKHRKKIRNEMWWCGEPMMRHLKRRYVRVNC
NCDGRTDIFFVKNSGWDRYGEHNDMITCSACEICLWHHEVKLFFANIEE*

DNA
ATGGTTCTCGTTTTCTTTGGTAACATCTTTGTAAAGGCTCATTTAACTTCCATGGGAAAAAGAGTATTTGTAGGCATTTC
AATAATCATGATGACATCAATCTACGCAGTCTCTTCCTCGCATAGTCCAAGTTTGGAGAAGCAAATTTCAAATTCTCCTC
GTGATCAATATTCTCTACCTGAAGACCTTCTTGTAGAAATCTCTTCATGTGTTGCAGCTTCATCTCTATCCGAGATTAGC
AATCTTCGATTAGTTTCGAAATCTTTTAAACGTATCAGCAACGATCGATACGTTCTGCGCCGGCTTTCCCTCAATGAAAT
CCCTCTTTTTCCATGGTTTCGCAACCGTGGAAAATTTCACAATTTTATCAAAAGATGTCGCAAGAATGGAAACCCCGAGG
CAATATACCGTAAAGGACTTGTCGATTACTTTCATCGAAATAGTTCTAAACGCCAACGAGACAAAGGACTCAAACATATA
GCAAAAGTTGCAAACAAGGGAAATCAAGAAGCACAATATGTTTATGGATTGATCCTAATTTGTCTTGGTGGCGAAACAAA
ACAAAAGGGTTTCAAGATCTTGTCTTCTTTAAGAAAACCTTTGATGTCAAGTACACTCGAGGAGATGGAAAAACATCGGA
AAAAGATCAGAAATGAGATGTGGTGGTGCGGCGAACCGATGATGAGACATCTCAAAAGAAGATATGTTCGTGTAAATTGC
AATTGTGATGGTCGAACAGATATTTTCTTTGTAAAGAATAGTGGTTGGGATCGTTATGGTGAGCACAACGACATGATTAC
TTGTTCTGCTTGTGAGATTTGTTTGTGGCATCATGAAGTCAAACTTTTCTTTGCTAATATTGAGGAATGA