Details for Lyrate rockcress Locus 16062730

Position : sca3 ( 5`- 587568 .. 589509 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16062730

Protein [Map View]
MVPPLLKLDFTQGPRAGDSLGFKPGSTIRIGRFVRGNEIAIKDAGISTKHLRIVSDSENWIIHDLGSSNGTILNSETIDP
DTPINLSHGDEIKLGEYTSILVNFVSDVVQAPQEHKLPPRPRRNNKRLAVSDPDPIESVQEKPKRTRGSSKQEENELPKK
TRASRKKTLDDIADKEEELEVEIEKKVKSRVGRPRKNAGSAVTKEEEVVEEKKGNSRARRGKNSESVEKSIKLEVEDTPR
AVEISEVKSRKRVARSKQIENACFGLEVKNEMRTTRSTRSKKTELGGDSFLELEMVLNQARKSRAKRKKVDQEPSKETIN
DDAGEEVLVNCHVEEDNDNEGREGCSERSDDKCDKEDEREGDGSKRVEQVEIELRKKSTLVEDGLNCTVREDGETENLQD
IEEENDNEKENGHEEGCSERCDKEDERVGDGSKRVEQVEIELRKKSTLGEDDLNCTVREDGETDNLQEIEEECHKKESEC
KVEEAGIATLDEEKVEQGWSNKNVERVEVDLGKMKLRDWFEAIEVQLPKQTIEETEKMIEPMRSKSMRVHKHIAEQKEKG

DNA
ATGGTTCCGCCATTGCTGAAGCTTGACTTCACCCAGGGTCCAAGAGCTGGCGATTCTCTAGGGTTTAAACCCGGATCCAC
TATCCGGATCGGTCGATTCGTCCGTGGTAATGAAATCGCCATAAAAGACGCTGGAATCTCTACCAAGCACCTCCGGATCG
TCTCCGATTCCGAGAACTGGATAATCCACGATCTTGGGTCTTCCAACGGCACCATATTGAACTCGGAGACTATCGACCCA
GATACGCCCATCAATCTTAGCCATGGAGACGAAATTAAGCTTGGTGAGTACACTTCCATTTTGGTGAACTTTGTGAGTGA
TGTTGTTCAGGCGCCGCAGGAGCATAAGCTTCCGCCCAGGCCAAGGAGGAACAACAAGCGTCTTGCTGTTTCGGATCCGG
ATCCTATTGAGTCGGTTCAGGAGAAACCAAAGCGCACGCGTGGATCGTCGAAGCAAGAGGAAAATGAACTGCCCAAGAAA
ACTAGGGCTTCGAGGAAGAAGACTCTGGACGATATCGCCGATAAAGAAGAGGAATTGGAGGTGGAAATTGAGAAGAAGGT
CAAATCTAGGGTTGGGAGGCCTCGGAAGAACGCAGGCAGTGCAGTTACGAAGGAAGAAGAAGTTGTGGAGGAGAAAAAAG
GCAACTCTAGGGCTCGGAGAGGTAAGAACAGTGAGAGTGTGGAGAAATCAATCAAATTGGAAGTTGAGGATACTCCCAGG
GCAGTGGAAATCTCAGAGGTCAAAAGCAGGAAGAGAGTGGCAAGGAGCAAGCAGATTGAAAATGCATGTTTTGGATTGGA
GGTTAAAAATGAGATGAGAACTACTAGGTCTACCAGAAGCAAGAAGACTGAACTTGGTGGAGATTCTTTTCTGGAGTTGG
AGATGGTCCTGAACCAAGCCCGGAAAAGCCGTGCAAAGAGGAAGAAAGTGGATCAGGAGCCGTCCAAGGAAACTATAAAT
GATGATGCCGGAGAAGAGGTTTTGGTGAACTGTCATGTTGAAGAAGATAATGATAATGAAGGTCGGGAAGGTTGCAGTGA
AAGAAGTGATGACAAATGTGATAAAGAAGATGAGAGGGAAGGTGATGGATCTAAGAGAGTCGAGCAGGTGGAGATTGAGT
TAAGGAAGAAGAGCACATTAGTAGAAGATGGCCTGAACTGTACTGTTAGAGAGGATGGAGAGACAGAGAACTTACAAGAT
ATTGAAGAAGAAAACGATAATGAAAAAGAAAATGGACACGAAGAAGGTTGCAGTGAAAGATGTGATAAAGAAGATGAGAG
AGTTGGTGATGGGTCTAAGAGGGTAGAGCAGGTGGAGATCGAGTTGAGGAAGAAGAGCACCTTAGGAGAAGATGACCTGA
ACTGTACTGTTAGAGAAGATGGAGAGACAGACAACTTACAAGAAATTGAAGAAGAATGTCATAAAAAGGAAAGTGAGTGC
AAGGTCGAGGAGGCTGGAATTGCGACATTAGATGAGGAAAAGGTTGAGCAGGGCTGGAGCAATAAGAATGTAGAGAGGGT
AGAAGTAGATTTAGGAAAAATGAAACTAAGAGATTGGTTTGAGGCCATAGAGGTTCAACTGCCAAAACAGACAATTGAAG
AGACAGAGAAGATGATAGAGCCCATGAGAAGTAAGAGTATGAGAGTTCACAAGCATATTGCAGAGCAAAAGGAAAAGGGC
G