Details for Lyrate rockcress Locus 16062702

Position : sca3 ( 5`- 10651755 .. 10652906 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16062702

Protein [Map View]
MVERFFPTKRSSGDGNRRRDKLTLLSGPISSGKTSLLFQFALNVASASTNNRVVFICHRKRIESNPPFLSQGIDPSSDVF
NRIQMKYVDDDEGIRKYFAAFHLHRVDDFPNAVIIDDFGDYFSQLNSMMNSRARDMAMVRTLALCHNAIADAKQAFCELV
LSETNHGDSPRSLFIYKRWIPKIFTIKGHGDGSFLLTSNGTSEKSAKYSIALQYLILEQMIDSY*

DNA
ATGGTGGAGAGATTTTTCCCGACGAAGCGGAGCTCCGGCGACGGAAATCGCCGGCGGGATAAACTAACTCTCCTCTCCGG
TCCAATTTCGTCAGGCAAAACCTCTCTACTCTTCCAATTCGCTCTCAATGTAGCGAGTGCTTCTACAAACAATCGTGTCG
TCTTCATCTGTCACCGGAAAAGAATTGAATCCAATCCTCCGTTTCTCTCTCAGGGAATCGATCCTTCCTCTGATGTATTC
AATCGAATTCAGATGAAATATGTGGATGATGATGAAGGAATCAGGAAATACTTTGCTGCGTTTCATCTTCATCGTGTTGA
TGATTTTCCAAATGCGGTTATAATCGATGATTTCGGCGATTACTTTAGTCAATTGAACTCGATGATGAATTCTCGGGCTA
GAGACATGGCGATGGTTCGGACTCTTGCTCTATGCCACAATGCTATAGCTGATGCTAAGCAAGCTTTTTGTGAGCTTGTA
TTGTCTGAGACTAACCATGGAGACTCCCCGAGGTCGTTGTTTATATACAAACGATGGATCCCGAAGATCTTTACGATAAA
AGGTCATGGTGATGGATCGTTTCTCTTGACAAGTAATGGTACATCCGAGAAAAGCGCCAAGTATTCGATCGCGCTGCAAT
ATCTCATCTTGGAGCAGATGATTGATAGTTATTAG