Details for Lyrate rockcress Locus 16062672

Position : sca3 ( 5`- 2925322 .. 2923714 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_317559 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16062672

Protein [Map View]
MSQTSENNNHDTASRKIFVGSLAWQTTTEDLRRFFEQFGEVIDANVVCETYPGRSKGYGFVTFKDAVSAARALENPRPVI
DGRTTNCNLASLRVKQNMNQPHKNELLNQVRPPHQYQPGLQHLIPYCTRVIWDSVSGQYRYMYNNPCYPFPTQMVHYNYN
YACITQPNSHQTNRKPVVISAPQKSSAPRHIINEIDQRAVPPKSSQELIVDDDNKEVVTKPDSDADQQRATGQAGDNIGK
DGDIKQDAMNQEGKINGQEYGMKQAVYAAIDDIHKFFMNEVTCEQKHDTNQDEDVTKEVLDNGIKVTHQDEDVQVAEDTL
*

DNA
ATGTCTCAAACCAGTGAGAACAATAATCATGATACTGCATCTAGGAAGATTTTTGTGGGAAGTTTAGCATGGCAAACAAC
AACAGAAGATTTGAGAAGATTCTTCGAACAATTCGGAGAAGTGATCGATGCTAATGTTGTTTGTGAAACTTATCCAGGAC
GATCCAAAGGCTATGGTTTTGTTACTTTTAAAGACGCTGTTTCTGCAGCTAGAGCTCTTGAAAATCCGAGACCGGTTATT
GATGGAAGAACAACCAACTGCAATTTGGCTAGTCTCCGTGTAAAGCAAAACATGAACCAACCTCACAAAAACGAATTATT
AAATCAGGTGAGACCCCCACATCAATATCAACCAGGTCTTCAACATCTAATTCCATATTGTACTCGAGTCATTTGGGATT
CGGTTTCGGGACAATATCGTTACATGTATAACAATCCATGTTATCCTTTCCCCACACAAATGGTCCATTACAATTATAAT
TATGCATGCATAACGCAACCGAATTCGCATCAGACAAACAGAAAACCTGTCGTTATCTCTGCGCCTCAAAAATCATCGGC
TCCACGTCACATCATTAATGAAATTGATCAAAGAGCTGTGCCTCCAAAATCATCGCAAGAACTCATTGTGGATGATGACA
ATAAAGAGGTTGTTACAAAACCAGATAGTGATGCTGATCAACAAAGGGCAACCGGTCAAGCAGGAGATAACATTGGAAAA
GACGGTGACATCAAGCAAGATGCAATGAATCAAGAAGGAAAGATCAATGGACAAGAATATGGCATGAAGCAAGCGGTATA
TGCAGCAATCGACGACATCCATAAATTTTTTATGAATGAGGTCACGTGTGAACAAAAACATGACACCAATCAAGATGAAG
ATGTAACAAAAGAGGTCCTTGATAATGGAATAAAGGTTACACATCAAGACGAAGATGTCCAAGTAGCTGAAGACACACTA
TAA