Details for Lyrate rockcress Locus 16062663

Position : sca3 ( 5`- 2192437 .. 2191029 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_477862 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16062663

Protein [Map View]
MAMQTVREGLFSAPQASWWTAFGSQPLAPESLAGDSDSFAGVKVGSVGETGQGVDKQSNSATHLAFSLGDVKSPRLVPKP
HGATFSMQSPCLELGFTQPPIYTKYPYGEQQYYGVVSAYGSQSRVMLPLTMETEDSTIYVNSKQYHGIIRRRQSRAKAAA
VLDQKKLSSRCRKPYMHHSRHLHALRRPRGSGGRFLNTKSQNSEKSGTNAKKADGSMQIQSQPKPQQSNSQNSEVVHPEN
GTMNLSNGLNVSGSEVTSMNYFLSSPVHSLGGMVMPSKWIAAAAGMDNGCSNFKT*

DNA
ATGGCTATGCAAACTGTGAGAGAAGGTCTCTTCTCTGCTCCACAGGCTTCTTGGTGGACTGCTTTTGGATCTCAGCCGTT
GGCTCCGGAGAGTCTCGCCGGCGATTCTGACTCGTTCGCCGGTGTTAAGGTCGGATCTGTCGGAGAGACAGGACAAGGTG
TGGATAAACAGAGCAACTCTGCAACTCACTTAGCTTTCTCACTTGGTGATGTAAAGAGTCCAAGACTTGTGCCAAAGCCT
CATGGAGCTACTTTCTCAATGCAATCGCCTTGCTTGGAACTTGGATTTACTCAGCCACCGATCTACACAAAGTATCCTTA
TGGGGAACAACAGTACTATGGAGTTGTTTCGGCCTATGGATCTCAGAGCAGGGTAATGCTTCCTCTAACCATGGAAACGG
AAGATAGTACCATCTATGTGAACTCAAAGCAATACCATGGAATCATAAGGCGACGCCAGTCCCGTGCAAAGGCTGCTGCT
GTTCTTGATCAGAAGAAATTGAGTAGTAGATGCCGCAAGCCATATATGCATCATTCGCGCCATCTCCATGCATTGCGGCG
TCCTAGAGGATCCGGTGGGAGATTCTTGAACACTAAAAGTCAGAACTCGGAAAAAAGCGGAACCAATGCAAAGAAAGCTG
ACGGAAGTATGCAGATCCAGTCTCAGCCTAAGCCTCAGCAAAGTAACTCTCAGAATTCTGAAGTTGTTCATCCGGAAAAC
GGGACCATGAACTTATCGAATGGATTAAATGTGTCGGGATCAGAAGTTACAAGCATGAACTACTTCCTAAGTTCTCCAGT
CCATTCTCTTGGTGGCATGGTAATGCCTAGCAAGTGGATAGCAGCAGCAGCAGGAATGGATAATGGCTGCAGCAATTTCA
AAACCTGA