Details for Lyrate rockcress Locus 16062662

Position : sca3 ( 5`- 6851504 .. 6854319 -3` )
Annotation : [B2G] binding protein
External links : CoGe
PGDD synteny : 16062662

Protein [Map View]
MDTSRRAVESYWRSRMIDGVTSDEDKVAPVYKLEEICDLLRSSHVSIVKEFSEFILKRLDNKSPIVKQKALRLIKYAVGK
SGSEFRREMQRNSVAVRNLFHYKGHPDPLKGDALNKAVRETAHETISAIFSEENGAKPAAPESINRRIEGFGNTNFQVPS
NDNKSFLSEVVGIGSASIKQGISNFAQGHLPKKNENGSSSYRGPNLHRSLTMENENFSRYDPVKLAKDGNYGMSKNTTGG
SWGHASGEASESSASVRVESKTREEKLLETIVTSGGVRLQPTRDALHVFILEAVKMDAVALSIALDEKLQSPMWQVRMKA
LCVLEAILRKKEDDNFSIVHTYFSENMDAIQRCSESPQSSLREKANKVLSLLNGGQSSGLMSSSDNTVKREAAVDLPDLI
DTGDSDYIKEDTLNNLNAIDTGSTVTKAAPLMDDDWFGDSSDTILSSSEKKNDDDPFADVSFHPNEEKVSADDLFSGMTV
GEKSAAAAGNHVPELFDMFGSTAKLEAEPKDSKNINDLMASFSIDENNSNQKSSSSSTLPEDLFAMPSTTSHQAPENPVG
GILGSQNPGFIQNTMLPGGVMPFNFPPGMMMNPAFASQPLNYAAIASLLAQQQQYLGNMSNFQQFGNLNAQGSGNVLSMG
TSGGNQSAFPDIFQPNFGNQAPTSTMNGSKKEDTRAFDFISDHLASTRDTKRVS*

DNA
ATGGATACGAGCAGGAGAGCTGTGGAATCGTATTGGAGGTCGCGGATGATAGATGGGGTTACGTCTGATGAGGACAAAGT
AGCGCCTGTGTACAAATTGGAAGAGATCTGTGACCTCCTTCGTTCTTCTCATGTCAGCATCGTCAAGGAGTTTTCTGAAT
TCATTTTGAAACGTCTTGATAACAAAAGCCCCATTGTTAAGCAGAAGGCTCTTAGGTTGATAAAGTATGCTGTGGGAAAG
TCTGGATCAGAGTTTAGACGAGAAATGCAAAGGAACTCGGTTGCAGTGCGCAATCTCTTCCATTACAAGGGGCATCCAGA
TCCTTTGAAAGGGGATGCACTTAATAAGGCTGTACGGGAAACTGCTCATGAAACAATATCTGCTATATTCTCGGAAGAGA
ACGGTGCTAAACCAGCTGCTCCTGAAAGCATCAACAGACGCATTGAAGGATTCGGGAATACTAACTTTCAGGTGCCCTCA
AATGATAATAAATCGTTCCTGAGTGAGGTGGTGGGTATTGGAAGTGCATCTATAAAGCAAGGAATCAGTAATTTTGCTCA
AGGCCATTTGCCAAAGAAGAATGAGAATGGAAGCAGCAGCTACAGAGGTCCAAATCTCCACAGATCATTAACTATGGAAA
ATGAGAACTTCAGTAGATATGATCCAGTTAAGCTGGCGAAGGATGGTAACTACGGAATGTCTAAGAACACTACTGGTGGA
TCTTGGGGCCATGCTTCCGGAGAAGCAAGTGAAAGTTCTGCTTCAGTTCGTGTTGAGAGCAAAACTCGTGAGGAAAAGCT
GCTGGAAACCATTGTTACGTCTGGCGGTGTACGCCTGCAGCCAACTCGTGATGCTCTTCATGTTTTCATTTTAGAGGCTG
TAAAAATGGACGCTGTTGCTTTAAGCATTGCTCTTGACGAGAAGCTCCAGTCTCCAATGTGGCAGGTTCGGATGAAAGCT
TTATGTGTCCTTGAGGCCATTTTGAGGAAGAAGGAAGATGATAATTTTTCAATTGTACATACCTATTTTAGTGAAAACAT
GGATGCCATACAGCGATGCTCAGAGTCTCCGCAATCTTCCCTTCGAGAAAAGGCTAACAAGGTTCTGAGCCTTCTAAATG
GTGGACAGTCAAGTGGGTTGATGAGCAGCTCAGATAATACTGTGAAGCGAGAGGCTGCTGTAGATTTACCTGACTTGATC
GACACCGGTGATTCAGATTATATAAAAGAAGATACTTTGAACAATCTGAATGCTATAGATACTGGCAGTACTGTGACGAA
AGCAGCTCCATTGATGGATGATGATTGGTTTGGGGATAGCTCTGACACTATACTGAGTAGCAGCGAGAAGAAAAATGATG
ATGACCCCTTTGCAGATGTATCATTTCATCCGAATGAAGAAAAAGTAAGTGCAGATGACCTGTTCTCTGGAATGACTGTC
GGGGAAAAGTCCGCTGCTGCTGCTGGTAATCATGTGCCTGAGCTATTTGATATGTTTGGGTCAACTGCAAAACTTGAAGC
AGAGCCAAAAGATTCAAAAAACATAAATGATTTGATGGCAAGTTTCTCCATTGACGAAAACAATTCAAATCAGAAAAGCT
CGTCTTCAAGCACCCTTCCAGAGGATTTATTTGCAATGCCGAGCACCACCAGCCACCAAGCACCGGAAAATCCTGTTGGA
GGCATTCTTGGCTCACAAAATCCTGGGTTTATCCAAAACACAATGCTTCCTGGGGGTGTTATGCCCTTCAATTTTCCTCC
AGGGATGATGATGAATCCAGCTTTTGCATCCCAACCTTTGAATTACGCTGCCATAGCAAGCTTGTTAGCTCAGCAGCAGC
AGTACCTTGGTAATATGTCCAACTTCCAGCAGTTTGGCAACCTGAACGCTCAGGGTAGTGGAAATGTTCTTTCTATGGGT
ACTAGTGGAGGGAATCAGTCAGCATTCCCTGATATATTCCAGCCAAATTTTGGTAATCAGGCTCCAACCTCAACAATGAA
TGGTTCGAAAAAAGAAGATACCAGAGCCTTCGATTTCATCTCTGATCATCTTGCATCAACCCGCGACACAAAGAGAGTAT
CTTGA