Details for Lyrate rockcress Locus 16062632

Position : sca3 ( 5`- 6353552 .. 6351999 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16062632

Protein [Map View]
MGGKNKIEILFHALWRRRISSSSSLVDLRSVPNHKNNITLSRFHLLGINQATHFLHSLAAPDKFPNGFNQSAVDVHNIIK
HHRGSSPEEIERILDKCGIQLTEELVFEVVNRNRSDWKPAYILSRLIVKHSVYISSSLVYNEILDVLGKMRRFEEFHQVV
DEMSKRDGFVDEKTYEVLLNRYAAAHKVDEAVGVFERRREFGIEDDLVAFHGLLMWLCRYKHVEFAETLFCSRRREFGCD
IRTMNIILNGWCVLGNVHEAKRIWKDIIASKCKPDVVSYGTMINALTKKGKLGKAMELYRALWETGRNPDVKICNNVIDA
LCFKKRIPEALEVFKEMSEKGPSPNVVTYNSLLKHLCKIRRTEKVWELVEEMEHKGGSCSPNDVTFGYLLKYSQRSKDVD
AVLERMAKNKCEMTSDLYNLMFRLYVQWDNEEKVREIWGEMERSGLGPDQRTYTIRIHGLHTKGKIGEALSYFQEMMSKG
MVPEPRTEMLLNQNKTKPRVEDKMLRSNLTSEESESD*

DNA
ATGGGAGGGAAAAACAAAATTGAAATCTTGTTTCATGCTCTATGGCGGCGCCGGATCTCTTCTTCCTCATCCTTGGTGGA
TCTTCGCAGTGTACCTAATCATAAGAACAACATCACTCTCTCCAGGTTTCACTTGCTGGGTATTAATCAAGCTACACACT
TTCTTCATTCTCTTGCAGCTCCCGACAAATTTCCTAATGGATTCAATCAATCTGCTGTTGATGTTCATAACATCATAAAG
CATCACCGTGGAAGTTCACCTGAAGAGATTGAGCGGATTCTCGATAAGTGCGGGATACAATTAACCGAAGAGCTGGTTTT
TGAAGTGGTTAATCGGAATCGATCTGATTGGAAACCAGCTTATATACTTTCTCGATTGATCGTTAAACATTCTGTTTATA
TATCTAGCTCCTTGGTTTACAACGAGATTCTCGATGTTCTTGGGAAAATGCGGCGCTTTGAAGAGTTCCACCAAGTGGTC
GACGAAATGTCTAAGAGAGATGGATTTGTTGACGAGAAGACGTATGAAGTTTTGTTAAACCGATACGCTGCTGCACACAA
AGTTGATGAAGCAGTAGGAGTGTTTGAGAGGAGGAGAGAGTTTGGGATAGAGGATGATTTGGTTGCATTTCATGGGCTTT
TGATGTGGTTGTGTAGGTATAAGCATGTCGAATTTGCGGAAACTTTGTTCTGCTCTCGTAGAAGAGAGTTTGGCTGCGAT
ATTAGAACGATGAACATAATTCTCAACGGTTGGTGTGTTTTGGGAAATGTTCATGAAGCCAAGAGGATTTGGAAAGATAT
AATTGCTTCTAAATGCAAGCCAGATGTTGTCAGCTACGGGACAATGATAAATGCATTGACGAAGAAGGGGAAGTTGGGAA
AGGCTATGGAATTATACAGAGCATTGTGGGAAACCGGAAGAAATCCGGATGTTAAAATCTGCAATAACGTTATTGATGCA
TTGTGTTTTAAGAAGAGAATCCCAGAGGCTCTTGAAGTATTCAAGGAGATGAGCGAGAAAGGTCCCTCCCCGAATGTTGT
GACGTACAACTCGCTTTTAAAGCATCTTTGCAAGATAAGGAGAACTGAGAAAGTTTGGGAGCTGGTGGAAGAGATGGAAC
ATAAAGGTGGTAGTTGTTCGCCTAACGATGTGACATTCGGTTACTTGCTTAAGTATTCGCAGAGATCGAAGGATGTTGAC
GCAGTTCTGGAAAGGATGGCGAAGAACAAGTGTGAAATGACAAGCGACTTGTACAATTTGATGTTTAGGTTATATGTGCA
ATGGGACAATGAAGAGAAAGTGAGAGAGATATGGGGTGAGATGGAGAGAAGTGGATTAGGTCCAGATCAGAGAACATATA
CTATTAGAATTCATGGTCTGCACACAAAGGGGAAAATTGGAGAAGCATTGAGTTACTTTCAAGAGATGATGTCTAAAGGA
ATGGTGCCAGAGCCAAGAACTGAGATGTTATTGAACCAGAACAAGACCAAGCCAAGAGTAGAAGACAAAATGCTTAGATC
AAACTTAACAAGCGAAGAGTCTGAAAGCGACTAA