Details for Lyrate rockcress Locus 16062577

Position : sca3 ( 5`- 22298943 .. 22298125 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16062577

Protein [Map View]
MDSLHVIKSFLLLLLIIVSIDLPRTTSSNSEPKVITIDVSQAQKLLDSGYTFLDVRTVEEFEEGHVDSEKVFNVPYWLYS
PQGQEINPNFLKHVSSLCNQTNHLVVGCKSGVRSLYATKVLVSSGFKNVKNMDGGYIAWVDKRFPVKVEHKELKYDEL*

DNA
ATGGATTCTTTACACGTTATAAAATCCTTTCTTCTTCTTCTTCTTATCATTGTTTCTATTGATCTTCCTCGCACGACTTC
ATCAAACTCAGAACCAAAAGTTATTACTATCGATGTAAGCCAAGCCCAGAAACTTCTTGATTCTGGCTACACGTTTCTTG
ATGTCAGAACTGTTGAAGAATTCGAGGAAGGCCATGTTGATTCAGAGAAAGTCTTCAATGTTCCTTACTGGTTATATTCT
CCACAGGGGCAAGAGATTAACCCTAATTTCTTGAAACATGTTTCATCTCTCTGTAACCAAACCAATCATCTCGTCGTGGG
ATGTAAATCGGGAGTTAGATCATTATATGCTACCAAAGTTCTTGTTTCTTCTGGCTTCAAGAATGTTAAAAACATGGACG
GTGGTTACATTGCTTGGGTCGACAAGAGATTTCCAGTTAAAGTGGAACACAAGGAACTCAAGTATGATGAGCTTTGA