Details for Lyrate rockcress Locus 16062376

Position : sca3 ( 5`- 10106111 .. 10104907 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_898737 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16062376

Protein [Map View]
MECVFGLVGNGFAIVAADTSAVHSILLHKNNEDKIMVLDSHKLVAASGEPGDRVQFTEYVQKNVSLYKFRNGIPLTTAAA
ANFTRGELATALRKNPYSVNILMAGYDNESGASLYYIDYIATLHKVDKGAFGYGSYFSLSTMDRHYRSDMSVEEAIELVD
KCILEIRSRLVVAPPNFVIKIVDKDGARDYAWRQSVKDVTTAAV*

DNA
ATGGAGTGTGTATTCGGTCTTGTTGGAAATGGATTCGCCATCGTCGCTGCTGATACATCGGCGGTTCACAGTATCCTTCT
CCACAAAAACAACGAAGACAAGATCATGGTTCTTGACTCTCACAAGCTTGTTGCTGCTAGTGGCGAGCCTGGTGACCGGG
TTCAATTTACGGAGTACGTTCAGAAGAATGTGTCGTTGTACAAATTCCGTAACGGAATCCCTTTGACTACCGCCGCTGCT
GCGAATTTCACTCGCGGAGAGCTCGCTACTGCGTTGAGGAAGAATCCGTATTCGGTGAATATCCTTATGGCTGGCTATGA
CAATGAGTCTGGTGCATCCCTTTACTACATTGACTACATTGCAACTCTTCACAAAGTCGACAAGGGAGCTTTCGGTTACG
GGTCCTATTTCTCCCTCTCCACGATGGACAGGCATTACCGCAGCGACATGTCTGTAGAAGAAGCCATTGAACTGGTTGAC
AAATGCATACTTGAGATCCGGTCAAGATTGGTCGTTGCACCGCCAAACTTTGTGATCAAGATTGTTGACAAAGATGGAGC
TCGTGATTACGCTTGGCGTCAGTCCGTAAAGGATGTCACAACTGCTGCTGTCTGA