Details for Lyrate rockcress Locus 16062361

Position : sca3 ( 5`- 1591011 .. 1589925 -3` )
Annotation : [B2G] nucleic acid binding protein
External links : CoGe
PGDD synteny : 16062361

Protein [Map View]
MAMEVATPAPAPIPSERNIVLAPATTTTTATVETHKKNRIQVSNTKKPLFFYVNLAKRYIQQHNEVELSALGMAITTVVT
ISEILKNNGLATEKKVLTSTVGMKDETKGRMVQKAKIEIVLGKSDKFDSLVPPVTNGKTPEEEASAETEASVEAQENVAA
ATEV*

DNA
ATGGCGATGGAAGTAGCAACACCGGCTCCGGCACCAATCCCATCGGAGAGGAACATCGTTCTCGCCCCTGCAACAACAAC
AACCACCGCCACTGTCGAGACTCACAAGAAGAACAGGATCCAAGTCTCCAACACCAAGAAACCATTGTTCTTCTACGTTA
ACCTCGCCAAGAGGTACATTCAGCAACACAACGAGGTCGAGCTTTCTGCACTTGGAATGGCAATCACTACTGTGGTAACA
ATCTCTGAGATCTTGAAGAACAATGGACTTGCAACAGAGAAGAAGGTGCTAACATCGACTGTGGGAATGAAAGATGAGAC
CAAAGGCCGGATGGTTCAGAAGGCAAAGATTGAGATAGTGTTGGGCAAGTCAGACAAGTTTGACTCTTTGGTGCCACCAG
TTACTAACGGCAAGACCCCGGAGGAGGAAGCTAGTGCAGAGACAGAGGCTTCTGTGGAAGCACAAGAAAACGTTGCCGCA
GCCACCGAGGTCTAG