Details for Lyrate rockcress Locus 16062359

Position : sca3 ( 5`- 3766158 .. 3768317 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_341089 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16062359

Protein [Map View]
MASPANFQLSRPKFNLLTYLERKSPQNLSFPLLFRDQANLTAAAALFSASFYFVYKPAATTPVAVVEETLEILSNDVKAL
SLLTEIKFKSDRHEQAIEVLDRLIEIEPDERKWPAMKARILSYHGKSELAIEAFERILEKDPIRVDAYHYLVMEYYNSKP
KLTELEKRINKVIRRCKKEKKAKEICGFRMLIAQIKFIQGNSLEAIRICEELVKDDPEDFTIYLFQGIVYILMNKEEEAA
KQFEQVARVMPMNHPSRETATTSKQWRVIVAYDNAFDAFLVYQVWKMKKRRFYILQHSYDFCKKIGGLNSSSRIKVHELR
EKSKSDLQNQLKELKAELALLRVAKVTGGAPNKLSKIKVVRKSIAQVLTVSSQKQKSALREAYKNKKFLPLDLRPKKTRA
IRRRLTKHQASLKTEREKKKEMYFPIRKYAIKV*

DNA
ATGGCGTCTCCGGCGAATTTTCAACTCTCTAGACCAAAATTTAACCTTCTGACCTACCTCGAGCGAAAATCTCCTCAAAA
TCTCTCCTTTCCCCTTTTATTCAGAGACCAAGCAAACCTCACCGCAGCCGCAGCTCTGTTCTCAGCATCCTTTTACTTCG
TCTACAAACCCGCCGCGACGACTCCGGTTGCTGTGGTAGAGGAGACTCTCGAGATACTATCAAACGATGTGAAAGCTTTA
TCATTGCTGACGGAGATCAAATTTAAGTCCGATAGACATGAGCAGGCAATAGAAGTTCTGGACCGTCTGATCGAGATCGA
GCCCGATGAACGAAAATGGCCGGCTATGAAGGCTAGGATTCTCTCATACCACGGAAAAAGCGAATTGGCAATCGAAGCTT
TCGAGAGGATTCTTGAGAAGGACCCGATACGTGTTGACGCTTATCATTACTTGGTGATGGAGTATTACAACTCTAAACCC
AAATTAACAGAGCTAGAGAAGAGAATCAACAAAGTGATTCGAAGATGCAAGAAGGAGAAGAAGGCGAAAGAGATTTGTGG
TTTCAGAATGTTGATCGCGCAGATCAAGTTTATCCAAGGAAACTCACTTGAAGCCATTCGGATTTGTGAAGAGTTAGTGA
AAGATGATCCAGAAGATTTCACTATATATCTGTTTCAAGGAATCGTGTATATATTGATGAATAAGGAAGAGGAAGCTGCG
AAGCAATTCGAGCAAGTTGCAAGGGTTATGCCGATGAATCATCCGTCCAGAGAGACTGCGACCACCTCAAAGCAATGGAG
AGTCATCGTAGCTTACGATAATGCTTTCGATGCCTTCCTTGTTTACCAAGTGTGGAAAATGAAAAAGCGGAGATTTTACA
TACTACAACACTCTTACGATTTTTGTAAGAAAATTGGTGGTTTAAACAGTTCATCGAGGATTAAGGTTCACGAGTTGAGG
GAAAAGTCGAAGAGCGATCTTCAAAACCAGCTTAAGGAACTCAAAGCTGAGCTCGCTCTCCTTCGTGTCGCCAAAGTCAC
CGGAGGTGCTCCTAACAAGCTCTCTAAAATCAAGGTTGTGCGTAAATCCATAGCTCAGGTTTTGACAGTGTCCTCTCAGA
AGCAGAAGTCTGCTCTAAGAGAAGCATACAAGAACAAGAAGTTTCTTCCTCTTGATCTCCGTCCCAAGAAGACCCGTGCT
ATCCGCAGACGTCTCACCAAACACCAGGCCTCTTTGAAGACAGAGCGTGAGAAGAAGAAGGAGATGTATTTCCCAATAAG
GAAGTACGCTATCAAAGTTTAA