Details for Lyrate rockcress Locus 16062358

Position : sca3 ( 5`- 9445981 .. 9444067 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16062358

Protein [Map View]
MGGMKDEAKRITIPPLFPRVHVNDTGRGGLSQPFDGKTMSLISCKRPNLPSPTNISDSLSTFSLSIPPPPNNARLIDGPE
KNQLSPICNTKFEGKMNKKGMNYPSPRGSSVTNTKPSSIKQNEYLKSLTNLDSIKVPDVRRSETDPKANTDLSLQFCTSS
SSKAGGEVIGSKILLSECLEDESQNGSPKVMQTQLYRRNFAEFSSETLKKPKTLPRREQDASDCSAIDSMSGISASSYNV
ARVIGERRFWKMRTQQKIFAGQVFELHRLIMVQKMIAKSPNLLLESKLNGGKHGTMRSSHQLTMAASKIKKPNIENHKPV
PEEYPEHMKPKLPLPSISKELVTPIWPQQLLPPPGNQWLVPVISPSEGLVYKPYAGPCPPPSSAFMVPVYGQDSIETAFR
FPVSSQFSHSYFPPPNARTTVDQTNPFGQYQRWSNTSSHMTQAIPFSLKKSQESNDSDIHGSTASSPPEKHKFEVLPLFP
TEPTHQTDEYKEKQQPVLRAIKAVPHTSTSASESAARIFRSIQEERRDSDHMIS*

DNA
ATGGGAGGAATGAAAGATGAAGCAAAGAGGATAACAATTCCTCCATTGTTCCCAAGGGTTCATGTGAATGATACTGGAAG
AGGAGGCTTGTCTCAACCATTTGATGGCAAAACAATGTCTCTCATCTCTTGTAAACGTCCCAATCTTCCTTCTCCGACCA
ATATCTCTGATTCTCTTTCCACTTTTTCTTTGTCAATTCCTCCACCACCAAACAATGCCCGTCTTATTGATGGACCTGAA
AAGAATCAGCTTTCACCAATCTGCAACACAAAGTTTGAGGGGAAGATGAATAAAAAAGGCATGAATTATCCAAGTCCTAG
AGGATCATCAGTTACTAATACTAAACCTAGTTCAATAAAACAAAATGAGTACCTCAAGAGCCTTACCAACCTGGATTCTA
TTAAGGTTCCTGATGTTAGACGCTCAGAAACAGATCCAAAAGCAAACACAGATTTGTCACTCCAGTTTTGTACTAGCAGT
AGCAGTAAAGCCGGAGGAGAAGTTATTGGTTCTAAGATCCTTTTGTCAGAATGTTTGGAAGATGAAAGCCAGAATGGGTC
TCCTAAGGTGATGCAAACTCAATTATATAGAAGAAACTTTGCTGAGTTTAGCAGTGAAACTCTAAAGAAGCCTAAAACTC
TGCCTCGGCGTGAACAAGATGCTTCAGACTGCTCTGCAATAGACTCTATGTCTGGTATAAGTGCATCTTCTTATAATGTT
GCCAGAGTGATAGGTGAAAGGAGGTTTTGGAAGATGAGAACTCAGCAAAAGATCTTTGCCGGGCAAGTATTTGAGCTGCA
TAGACTCATAATGGTTCAAAAGATGATTGCGAAATCGCCAAACTTGCTTCTTGAAAGTAAGCTTAATGGCGGCAAACATG
GGACAATGAGGTCATCCCATCAGCTGACAATGGCCGCTTCAAAGATTAAAAAACCAAACATTGAGAATCACAAACCTGTA
CCTGAAGAATATCCAGAGCATATGAAACCAAAGCTTCCTCTACCTTCCATAAGCAAAGAACTCGTGACCCCAATTTGGCC
ACAACAGCTACTTCCTCCTCCTGGAAACCAATGGTTAGTTCCTGTAATATCTCCTTCAGAAGGTCTGGTCTATAAACCAT
ATGCAGGACCATGTCCTCCTCCTTCTTCAGCCTTCATGGTTCCAGTTTATGGCCAAGATTCCATTGAGACAGCATTCAGG
TTCCCTGTTTCTTCTCAATTTAGCCACAGCTACTTCCCACCACCTAACGCGAGGACAACAGTTGACCAAACAAACCCGTT
TGGCCAGTATCAAAGATGGTCTAACACATCAAGCCACATGACTCAAGCCATACCATTTTCCTTAAAGAAGTCTCAGGAAT
CTAATGACAGTGACATACATGGAAGCACAGCTTCAAGTCCACCAGAGAAGCATAAATTTGAAGTGCTTCCTCTGTTTCCT
ACAGAGCCTACCCATCAAACTGATGAGTACAAGGAGAAACAGCAACCGGTGCTTCGTGCCATTAAAGCCGTTCCTCATAC
TTCAACATCTGCCTCTGAATCTGCTGCAAGGATCTTCCGTTCCATTCAGGAAGAAAGGAGGGACTCAGATCATATGATTA
GTTAG