Details for Lyrate rockcress Locus 16062330

Position : sca3 ( 5`- 3133747 .. 3132592 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_896904 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16062330

Protein [Map View]
MGKEDDRGEEYLFKIVLIGDSAVGKSNLLSRFSRDEFDTNSKATIGVEFQTQLVEIEGKEVKAQIWDTAGQERFRAVTSA
YYRGAFGALIVYDITRSDTFESVKRWLQELNTHCDTAVAQMLVGNKCDLEDIRAVSVEEGKALAEEEGLFFMETSALDAT
NVDKAFEIVIREIFNNVSRKLLNSDAYKAELSVNRVSLVNNQDGSESSWRNPSCCSR*

DNA
ATGGGTAAGGAAGACGACCGAGGAGAAGAGTACTTGTTCAAGATTGTCCTAATCGGCGATTCGGCTGTCGGAAAATCGAA
CCTGCTGTCTCGCTTTTCTCGGGACGAGTTCGACACGAACTCGAAGGCGACAATCGGAGTGGAATTTCAGACGCAGCTGG
TGGAAATCGAAGGGAAAGAAGTGAAAGCTCAGATCTGGGACACTGCTGGTCAAGAGAGGTTTAGGGCAGTCACTTCTGCT
TATTACAGAGGTGCTTTTGGTGCTCTCATCGTTTATGACATCACTCGAAGTGACACTTTCGAAAGCGTTAAACGTTGGCT
TCAGGAACTCAACACTCATTGTGACACTGCTGTGGCACAAATGCTAGTTGGAAACAAATGTGATTTGGAGGATATCAGAG
CGGTCAGTGTGGAGGAAGGGAAAGCTCTTGCGGAGGAAGAAGGACTGTTCTTCATGGAGACATCTGCTCTGGACGCCACA
AATGTAGACAAAGCCTTTGAGATTGTCATCAGAGAGATCTTCAACAATGTCAGCCGCAAACTTCTCAACTCCGATGCTTA
CAAGGCCGAGCTTTCTGTTAACCGGGTCAGCCTTGTCAACAACCAAGATGGCTCCGAGAGCTCTTGGCGGAATCCGTCAT
GTTGCTCCCGATGA