Details for Lyrate rockcress Locus 16062313

Position : sca3 ( 5`- 1642370 .. 1649101 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_477743 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16062313

Protein [Map View]
MAELGQQTVDFSALVGRTAEESFLSLKELVEKSKSTELSDNEKKVSLLKYVAKTQQRMLRLNALAKWCKQVPLINYFQDL
GSTLSAHDICFTQAADSLFFMHEGLQQARAPVYDVPSAVEILLTGSYQRLPKCLDDVGMQSSLDEHQQKPALRKLEVLVR
SKLLEITLPKEITEVKISKGTVTFSVDGEFKVLVTLGYRGHLSMWRILHLDLLVGERSGPIKLEVTRRHILGDDLERRMS
VAENPFTILYAVLHELCVAIVMDTVIRQVRALLQGRWKDAIRFDLISDTGTTPANQEGEADSVSLRTPGVKLMYWSDSDK
NSGPFIKIEPGSDLQIKCSHSTFVIDPLTGKEAEFSLDQSCIDVEKLLLKAICCNRYTRLLEIQKELLRNARICRAPSDV
ILQALLDEPGIEGGNMVDSKERVEPEVLRVRAYGSSFFTLGINIRTGRFLLQSSKSILTSSILEEFEDALNQGSISAVDA
FINLRSKGILHFFAAIGKFLGLEVYEHGFGINKVPKSLLDGSSILTLGFPDCESSHLLLMELEKDFTPLFKLVETRMDGS
GKPQSFNDPSNILRAKKIDIGQIRILEDDLNLNTSDVVKFVSSSSDAEGINQVSGHRHPGLVDDALTEMSGSQLSFSSIV
DEVFGLQKERSALVSSDGHGLVPKNLSAVNGPGKAPMLTSYHSDSLYNLQGPLQSSSYNMLSSPPGMGSAMKKIAISNSD
QELSMILSPSLSAGNGVSESGSRMVTESSLSALPLSQTADLATTSVGPLLRKDQKPRKRSASDLLRLIPSLQGMEGVASP
IKRRKTSELVQSELVKSWSPASQTLSTVATSTKTIGCSYGNLIAEANKGNAPSSVFVYALLHVVRHSSLSIKHAKLTSQM
EALDIQYVEEMGLRDAFSDIWFRLPFAQNDSWQHICLQLGRPGSMCWDVKINDQHFMDLWELQKGSKTTPWGSGVHIANS
SDVDSHIRYDPEGVVLSYQSVEADSIKKLVADIQRLSNARMFSLGMRKLLGIKPDEKTEECSANSTIKGSAGGKGSGETV
DRWKAFKIEAVGLTSLWFSFGSGVLARFVVEWESGKDGCTMHVSPDQLWPHTKFLEDFINGAEVESLLDCIRLTAGPLHA
LAAATRPARASTATGMPVVPAAASSRQSNQIQQTQGIVAPSTLAAPNATGQSVSATSGNTVASSAPSPLGGSFHGVAMLA
AAGRSGPGIVPSSLLPIDVSVVLRGPYWIRIIYRKRFAVDMRCFAGDQVWLQPATPPKGGASIGGSLPCPQFRPFIMEHV
AQELNGLEPNLTGSQGATNPNSGNPTVNGGNRVNFSPSSAMSRAAMNRVASVASGSLVVSPGLSVRRTPGTAVPAHVRGE
LNTAIIGLGDDGGYGGGWVPLVALKKVLRGILKYLGVLWLFAQLPDLLREILGSILKDNEGALLNLDQEQPALRFFVGGY
VFAVSVHRVQLLLQVLSVRRFHHQQQQNGSSAAAQEELTQSEIGEICDYFSRRVASEPYDASRVASFITLLTLPISVLRE
FLKLIAWKKGLSQSQQAGEIAPAQRPRIELCLENHSGTDLDNNCAAKSNIHYDRPHNTVDFALTVVLDPVHIPHINAAGG
AAWLPYCVSVRLRYTFGESPSVTFLGMEGSHGGRACWQRVDDWEKCKQRVSRTVEVNGSAAGDLTQGKLKLVADSVQRTL
HLCLQGLREGNSSNTLQKEFTI*

DNA
ATGGCGGAATTAGGGCAACAGACGGTGGATTTCTCCGCTCTTGTTGGTCGAACCGCAGAGGAATCGTTCCTTTCTCTTAA
GGAACTCGTGGAAAAGTCTAAGTCGACGGAGCTTTCTGATAATGAAAAGAAGGTTAGCCTCCTTAAGTATGTTGCTAAGA
CTCAGCAACGGATGCTCCGCCTCAATGCCCTCGCCAAGTGGTGTAAACAGGTTCCTCTTATAAATTACTTTCAAGACCTT
GGGAGCACATTATCAGCTCATGATATATGCTTCACACAAGCTGCGGATTCGCTGTTTTTTATGCATGAAGGTCTACAGCA
AGCTCGCGCTCCTGTCTATGATGTTCCCTCTGCTGTTGAGATTTTGCTGACAGGTTCTTATCAGCGCCTGCCAAAGTGTC
TAGACGATGTGGGGATGCAGAGCTCTTTGGATGAGCATCAACAGAAACCAGCTCTAAGAAAGCTGGAGGTTCTTGTACGT
TCCAAACTACTTGAAATCACACTTCCAAAAGAAATAACAGAGGTGAAAATTTCTAAAGGTACAGTTACCTTTTCTGTCGA
CGGGGAATTTAAGGTTCTTGTTACTCTTGGTTACCGAGGGCACCTATCCATGTGGAGGATATTGCATTTGGATCTACTTG
TTGGTGAAAGAAGTGGCCCCATTAAACTCGAAGTGACAAGACGGCATATCCTTGGAGATGATTTAGAGCGCCGAATGTCC
GTGGCAGAAAATCCATTCACAATATTATATGCGGTGCTCCATGAGCTGTGCGTTGCCATTGTCATGGACACAGTCATAAG
ACAGGTCCGAGCTCTTCTCCAGGGGAGATGGAAAGATGCAATTCGCTTCGACTTAATTTCAGATACTGGCACCACACCAG
CGAACCAAGAAGGAGAGGCAGATTCTGTTAGTCTTCGAACTCCAGGAGTGAAACTTATGTACTGGTCAGATTCTGATAAA
AACTCTGGCCCATTCATTAAAATTGAACCAGGGTCAGATCTCCAGATTAAATGTTCTCACAGCACATTTGTAATTGACCC
ACTTACTGGCAAGGAAGCTGAGTTTTCTCTCGACCAGAGCTGCATTGACGTGGAGAAGCTTCTGCTTAAAGCTATATGCT
GTAATAGATATACCCGTCTTCTTGAAATTCAGAAAGAGCTTTTGAGGAATGCTCGTATTTGTCGAGCTCCAAGTGATGTC
ATCCTTCAGGCCCTCCTGGATGAGCCTGGTATTGAGGGAGGTAACATGGTAGATTCTAAGGAACGAGTAGAGCCAGAGGT
CTTACGTGTGCGAGCCTATGGATCTTCATTTTTCACACTCGGGATAAATATAAGGACTGGTCGGTTTCTTCTTCAGTCAT
CCAAGAGTATCTTGACCTCCTCCATCTTGGAGGAATTTGAAGATGCATTAAACCAAGGAAGTATATCTGCAGTTGATGCC
TTTATCAACTTGAGAAGCAAAGGCATTTTGCATTTTTTTGCTGCCATTGGCAAATTTTTGGGTCTTGAGGTCTACGAACA
TGGTTTTGGTATAAACAAAGTTCCTAAAAGCCTCTTGGATGGGTCAAGCATTCTGACTTTGGGATTTCCTGACTGTGAAA
GCTCTCACCTTTTGCTCATGGAGCTCGAAAAAGACTTCACACCATTGTTTAAATTAGTGGAAACTCGGATGGATGGTTCG
GGAAAACCTCAGTCTTTCAATGATCCAAGCAATATTTTGCGAGCTAAGAAAATTGATATAGGGCAGATACGGATTCTCGA
AGATGATCTTAACTTAAATACATCCGATGTGGTTAAATTTGTATCTTCATCCTCAGATGCTGAGGGTATAAATCAAGTAT
CTGGACACCGTCATCCTGGATTGGTTGATGATGCTTTGACAGAAATGAGTGGAAGCCAGTTGAGTTTCTCCAGCATTGTA
GATGAAGTGTTTGGACTTCAGAAAGAGAGATCGGCTCTTGTGTCAAGTGATGGGCATGGTTTAGTTCCCAAGAATCTCTC
TGCTGTTAACGGCCCTGGAAAAGCTCCAATGTTGACTAGCTACCATTCAGATTCCTTGTATAATCTACAGGGTCCCTTAC
AATCCAGCTCTTATAATATGTTATCATCTCCCCCTGGGATGGGTTCAGCTATGAAGAAGATAGCCATCTCTAACTCTGAC
CAGGAGTTATCCATGATACTGTCTCCATCCCTCTCTGCTGGGAACGGAGTCTCTGAGTCAGGCTCTAGAATGGTCACTGA
ATCCTCATTGTCAGCTCTTCCTCTATCTCAAACAGCTGATCTTGCAACAACATCTGTTGGTCCTTTGTTGAGAAAAGATC
AGAAGCCCCGGAAACGTTCAGCTTCAGATTTACTAAGATTGATCCCATCCCTCCAGGGAATGGAAGGTGTTGCTAGTCCC
ATTAAGAGAAGAAAAACCTCTGAACTGGTACAGAGTGAATTAGTGAAGAGTTGGAGCCCTGCATCACAGACCTTATCCAC
CGTGGCAACATCAACAAAAACTATAGGATGCAGCTATGGGAATCTCATAGCTGAAGCAAACAAGGGGAATGCACCTTCAA
GCGTTTTTGTCTATGCTCTTCTCCATGTTGTCAGGCATTCTTCGTTGTCCATAAAGCATGCCAAACTAACTAGTCAGATG
GAGGCACTGGATATTCAATATGTTGAGGAAATGGGACTAAGAGATGCATTTTCAGATATATGGTTCCGTCTTCCATTTGC
TCAAAATGATTCCTGGCAACATATATGCTTGCAGCTTGGTAGACCTGGAAGCATGTGTTGGGATGTGAAAATAAATGACC
AACACTTTATGGATCTCTGGGAACTTCAAAAGGGAAGTAAAACCACACCATGGGGATCTGGAGTTCACATTGCGAATTCT
TCTGATGTTGATTCCCATATCCGTTATGACCCTGAAGGTGTAGTTCTGAGCTATCAGTCTGTGGAAGCTGATAGTATAAA
GAAGCTTGTGGCCGACATACAGAGGCTGTCAAATGCTAGAATGTTCTCCCTTGGTATGCGGAAACTACTTGGCATAAAGC
CAGATGAAAAAACAGAAGAGTGCAGTGCTAATTCCACTATTAAAGGATCTGCTGGTGGGAAAGGCAGTGGTGAGACAGTA
GATAGATGGAAAGCTTTCAAGATTGAGGCAGTGGGATTAACAAGCCTGTGGTTTAGCTTTGGTTCAGGCGTTTTGGCGCG
TTTTGTTGTCGAGTGGGAATCAGGTAAAGATGGATGCACCATGCATGTCTCTCCTGACCAACTATGGCCACATACAAAGT
TCTTGGAAGATTTCATAAATGGAGCTGAGGTAGAATCTCTTTTGGATTGCATCCGCCTTACTGCTGGGCCTTTGCATGCA
TTAGCTGCTGCTACTCGCCCTGCCCGAGCTAGTACTGCCACTGGTATGCCTGTCGTACCTGCTGCAGCGTCTTCAAGACA
ATCAAATCAGATACAACAAACTCAAGGAATTGTTGCCCCTTCAACTTTAGCAGCTCCTAATGCTACTGGCCAGTCTGTCT
CAGCAACTTCAGGAAATACTGTTGCTTCTTCTGCTCCAAGCCCACTCGGTGGAAGTTTCCATGGAGTTGCAATGCTAGCA
GCTGCAGGGAGAAGCGGACCTGGCATCGTTCCAAGCTCTCTCTTGCCCATCGATGTCTCTGTAGTACTCCGTGGACCCTA
TTGGATAAGGATCATATACCGTAAACGTTTTGCAGTGGACATGAGATGTTTTGCTGGAGATCAAGTCTGGTTGCAACCAG
CAACTCCACCCAAGGGTGGTGCTTCTATTGGAGGCTCCTTGCCATGTCCCCAATTCAGACCTTTCATCATGGAGCATGTT
GCTCAAGAATTGAACGGTTTAGAACCAAATTTGACAGGTAGCCAAGGAGCAACAAATCCCAACAGTGGAAACCCAACTGT
TAACGGTGGGAACAGAGTTAACTTTTCCCCTTCTAGTGCAATGTCAAGAGCCGCCATGAATCGTGTAGCCAGTGTTGCTT
CAGGATCTCTAGTGGTTAGCCCAGGATTGTCTGTGCGTAGAACACCAGGCACTGCTGTACCAGCACATGTAAGAGGCGAA
TTAAACACAGCGATTATCGGGTTAGGTGATGATGGTGGCTATGGCGGAGGATGGGTTCCTCTTGTGGCTCTAAAAAAGGT
TTTGCGTGGTATCCTTAAATATCTTGGAGTACTGTGGCTATTTGCTCAGTTACCAGATCTCTTAAGAGAGATCTTAGGTT
CAATCTTGAAGGATAACGAAGGTGCTCTCTTGAATTTAGACCAAGAACAACCAGCCTTACGCTTCTTTGTCGGTGGCTAT
GTATTTGCGGTGAGTGTCCATAGAGTTCAGCTCCTTCTTCAAGTCCTTAGCGTAAGGCGATTCCATCACCAGCAGCAACA
AAATGGTTCTTCCGCTGCTGCTCAAGAGGAGTTAACCCAATCCGAGATTGGAGAAATCTGCGATTATTTTAGCCGCCGTG
TCGCATCAGAACCGTATGATGCTTCAAGAGTTGCCTCTTTCATAACACTCCTCACGTTACCCATATCGGTCTTGAGAGAG
TTTCTGAAACTGATAGCTTGGAAAAAAGGATTATCCCAATCACAACAAGCTGGAGAGATTGCTCCTGCACAGAGACCTCG
AATCGAGCTATGTCTAGAGAATCATTCCGGTACAGATTTAGACAACAATTGTGCAGCTAAAAGCAATATCCATTACGACC
GGCCACACAACACGGTTGACTTTGCTCTAACCGTCGTTCTTGATCCTGTGCACATACCCCATATAAACGCTGCTGGAGGA
GCAGCATGGTTGCCTTACTGTGTATCGGTTAGGTTAAGATACACATTTGGCGAAAGCCCTAGTGTGACGTTTCTTGGAAT
GGAAGGAAGCCATGGAGGTCGAGCTTGTTGGCAGCGAGTGGACGATTGGGAGAAATGTAAACAGAGAGTGAGTCGTACAG
TGGAAGTTAACGGATCTGCTGCAGGAGATTTGACTCAAGGAAAACTCAAGTTGGTTGCAGATAGTGTCCAGAGAACATTG
CATCTATGTCTTCAAGGTCTGAGAGAAGGTAATAGCAGCAACACTCTTCAAAAGGAATTTACCATATAG