Details for Lyrate rockcress Locus 16062308

Position : sca3 ( 5`- 1656332 .. 1654536 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16062308

Protein [Map View]
MTPFSSELVGFTIPFYSKTQKHYSNSSHGLSHNRSLLTFSNSNPNHDNGKSFSSSGARNLQATTTDAAIPTERRQQHSQS
LGFRDTQMLKIFHRSCRSGNYIESLHLLETMVRKGYNPDVILCTKLIKGFFTLRNVPKAVRVMEILEKFGQPDVFAYNAL
INGFCKMNRIDDATRVLDRMRSKDFSPDTVTYNIMIGSLCSRGKLDLALKVLDQLLSDNCQPTVITYTILIEATMLEGGV
DEALKLLDEMLSRGLKPDMFTYNTIIRGMCKEGMVDRAFEMIRNLELKGCEPDVISYNILLRALLNQGKWEEGEKLMTKM
FSEKCDPNVVTYSILITTLCRDGKIEEAMNLLKLMKEKGLTPDAYSYDPLIAAFCREGRLDVAIEFLETMISDGCLPDIV
NYNTVLATLCKNGKADQALEIFGKLGEVGCSPNSSSYNTMFSALWSSGDKIRALHMILEMVSNGIDPDEITYNSMISCLC
REGMVDKAFELLVDMRSCEFHPSVVTYNIVLLGFCKAHRIEDAIDVLDSMVGNGCRPNETTYTVLIEGIGFAGYRAEAME
LANDLVRINAISEYSFKRLHRTFPLLNVLQRSSQTFGH*

DNA
ATGACTCCATTCTCCTCTGAACTCGTTGGTTTCACTATCCCTTTCTACTCCAAAACTCAGAAACACTATTCAAATTCTTC
TCACGGACTATCTCACAATCGAAGCCTCTTAACCTTCTCAAACTCTAACCCTAACCACGACAATGGAAAATCCTTTTCAT
CTTCAGGAGCAAGAAACCTTCAAGCCACCACAACAGACGCAGCAATTCCCACGGAACGAAGACAACAACACTCACAATCT
CTCGGATTTAGAGATACCCAGATGCTTAAAATCTTCCATCGATCATGCCGTTCAGGGAATTACATCGAATCTCTACACTT
ACTCGAGACCATGGTACGTAAAGGATACAATCCTGATGTGATTCTCTGCACTAAGCTCATTAAAGGGTTCTTCACTCTAA
GAAACGTCCCAAAAGCTGTTAGGGTTATGGAGATTCTCGAGAAATTCGGACAGCCTGATGTTTTTGCTTACAACGCTTTG
ATTAATGGGTTTTGTAAGATGAATCGGATCGATGATGCTACGAGAGTTCTTGATAGGATGAGAAGTAAAGATTTTTCACC
AGATACTGTTACTTACAACATAATGATTGGTAGTTTGTGTAGCAGAGGTAAACTTGATCTTGCTTTGAAGGTTTTAGATC
AATTGTTAAGTGATAACTGCCAACCGACTGTGATTACTTACACGATTTTGATCGAAGCTACGATGCTTGAAGGCGGAGTT
GATGAAGCATTGAAGCTTTTGGATGAGATGTTGTCTAGAGGGTTGAAACCTGATATGTTTACTTATAACACAATCATTAG
AGGAATGTGTAAAGAAGGGATGGTAGATCGCGCGTTTGAGATGATTCGGAATTTGGAATTGAAAGGTTGTGAGCCTGATG
TGATCTCTTATAACATCTTGCTTCGTGCTCTTTTGAATCAAGGGAAATGGGAAGAAGGAGAGAAGCTAATGACTAAGATG
TTTTCAGAGAAGTGTGATCCTAATGTTGTGACTTATAGCATTTTGATAACTACTCTATGCCGCGATGGAAAGATTGAAGA
AGCGATGAATCTGCTTAAGCTTATGAAGGAAAAAGGGTTAACTCCTGATGCTTATAGCTATGATCCTTTGATAGCTGCGT
TTTGTAGAGAAGGTAGGTTAGATGTAGCTATTGAGTTCTTGGAAACCATGATCTCTGACGGATGTTTACCGGACATAGTT
AACTACAACACGGTTTTAGCTACGTTGTGCAAGAACGGGAAAGCGGATCAAGCGTTGGAGATTTTCGGGAAACTAGGAGA
AGTGGGCTGCTCACCGAACTCGAGTTCTTACAATACGATGTTCAGTGCCTTATGGAGCAGCGGGGATAAAATCAGGGCGT
TACATATGATATTAGAGATGGTGAGTAACGGGATAGATCCCGATGAGATCACATATAACTCGATGATATCGTGTCTATGC
AGAGAAGGAATGGTGGATAAAGCTTTTGAGTTATTGGTTGATATGAGGAGCTGTGAGTTTCATCCATCGGTTGTTACATA
CAACATTGTTCTTTTGGGATTCTGCAAAGCTCATAGGATCGAGGACGCAATCGATGTTTTGGATTCAATGGTGGGAAATG
GATGTAGGCCTAACGAAACTACTTATACTGTGCTCATTGAAGGCATTGGTTTTGCTGGATACAGAGCAGAAGCAATGGAG
TTAGCAAATGATTTGGTTCGAATCAATGCCATTTCTGAGTACTCGTTCAAGAGATTGCATAGGACTTTCCCTTTACTCAA
TGTTTTACAGAGATCTTCTCAGACATTTGGTCATTAA