Details for Lyrate rockcress Locus 16062295

Position : sca3 ( 5`- 4336113 .. 4337506 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16062295

Protein [Map View]
MEQLKVKKTIGNTSKRVTRSQTYPFEGIMPLNLKEEILMKLKAKTISKLILLSKSWSSIVLNKDFTNMYLTQSLARPRLL
FSIYNLDIDVHFFHSCSQEDPSSDHQRVRCYPDSNSASWYDYSPPVRGLICCLENLYTKVVIGNPTTCQFVTLPRVRTKK
KDIFPDIFPFLGYDPVKDEYKVLCMTIAANHKGNVVSKEHQVFTLGGKKKKWRMIDCEINHYLPPRTKGICSNGVVYYLA
MVNHVQSLMCFDVGSEKFSVVKLPGKVGILAKYGEKIAVTNLLFDCIRLDVWILEDASKQEWSNIYVLVPSCVNRSFSFR
GILGTGELLFAPEPTSFYLLCYDLKEHKARKIWIKGLGDYTNIEVFLDHVENPMVLSKISFGFLI*

DNA
ATGGAGCAGCTTAAGGTGAAAAAGACAATCGGTAACACTTCAAAACGTGTTACAAGGTCCCAAACTTACCCCTTCGAAGG
AATAATGCCTCTGAATCTGAAAGAGGAGATTCTCATGAAATTGAAGGCCAAAACCATATCGAAGCTGATCCTCCTTTCGA
AGTCATGGTCATCGATAGTCCTTAACAAAGATTTCACCAACATGTACCTGACTCAATCCTTGGCTCGACCACGTCTTCTT
TTCTCAATCTACAATCTTGACATAGATGTGCATTTCTTCCACTCTTGCTCTCAAGAGGATCCATCTTCTGATCATCAAAG
GGTTAGGTGTTACCCTGATTCGAATTCGGCTAGCTGGTATGACTATTCTCCACCTGTCCGTGGCTTGATCTGCTGTCTAG
AAAATCTATATACTAAAGTGGTAATTGGAAATCCTACTACTTGTCAATTTGTAACTTTACCTAGAGTCAGAACTAAGAAG
AAAGACATATTCCCAGACATATTCCCCTTTTTGGGATATGATCCTGTTAAGGATGAATACAAAGTCTTGTGCATGACGAT
AGCAGCCAATCATAAAGGAAATGTTGTGTCCAAGGAACATCAAGTTTTCACTCTAGGAGGTAAAAAGAAGAAATGGAGAA
TGATCGATTGTGAGATTAATCATTATCTTCCTCCTAGAACTAAAGGGATATGTAGCAATGGGGTTGTGTATTATCTAGCT
ATGGTCAACCATGTTCAGTCTCTAATGTGCTTTGATGTGGGGTCTGAAAAGTTTAGTGTCGTTAAGTTACCGGGGAAGGT
CGGAATTCTAGCGAAGTACGGCGAAAAGATAGCTGTAACGAATTTGTTATTTGACTGTATACGACTTGACGTTTGGATTC
TAGAAGATGCCAGCAAACAAGAATGGTCAAATATTTATGTCTTGGTTCCTTCTTGTGTAAATCGATCATTCAGCTTCAGG
GGTATACTTGGTACCGGCGAGCTTTTATTTGCACCGGAACCTACGTCTTTTTATTTACTATGTTACGATCTCAAGGAACA
CAAAGCTAGAAAAATCTGGATCAAAGGACTTGGAGATTATACTAATATTGAAGTCTTTTTGGATCATGTAGAAAATCCTA
TGGTTCTGTCAAAGATAAGCTTCGGTTTTCTTATTTGA