Details for Lyrate rockcress Locus 16062273

Position : sca2 ( 5`- 15860043 .. 15859105 -3` )
Annotation : [B2G] ATMKK9 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16062273

Protein [Map View]
MALVRERRQLNLRLPLPPISDRRFSVSSSVTTTTVAATSGCNGISAGDLEKLNVLGCGNGGIVYKVSHKTTSEIYALKTV
NGDMDPIFTRQLMREMEILRRTDSPYVVKCHGIFEKPVVGEVSILMEYMDGGTLESLRGGVTEQKLAGFAKQILKGLSYL
HALKIVHRDIKPANLLLNSRNEVKIADFGVSKILVRSLDSCNSYVGTCAYMSPERFDSESSGGSSDIYAGDIWSFGLMML
ELLVGHFPLLPPGQRPDWATLMCAVCFGEPPRAPEGCSEEFRSFVECCLRKDSSKRWTASQLLAHPFLREDL*

DNA
ATGGCTTTAGTTCGTGAACGTCGTCAGCTAAATCTCCGTCTTCCTCTTCCTCCGATTTCCGACCGCCGCTTCTCCGTCTC
CTCCTCCGTCACCACCACCACCGTCGCTGCTACCTCCGGCTGTAATGGAATCTCCGCCGGTGATCTCGAGAAACTCAACG
TTCTCGGATGCGGTAACGGCGGGATTGTTTATAAAGTCAGTCATAAAACCACATCGGAGATCTACGCTTTGAAAACAGTT
AACGGCGACATGGATCCGATTTTCACAAGGCAATTGATGCGAGAGATGGAGATTCTCCGCCGTACAGATTCACCGTACGT
CGTTAAATGTCACGGAATCTTCGAGAAACCTGTCGTCGGTGAAGTATCGATTCTAATGGAGTATATGGACGGAGGAACCC
TAGAATCACTACGCGGCGGCGTAACGGAGCAAAAACTCGCCGGATTCGCTAAGCAGATCTTAAAAGGATTAAGCTATTTA
CACGCTCTTAAGATCGTTCATCGTGATATCAAACCGGCGAATCTGCTTCTCAATTCGAGAAACGAAGTTAAAATCGCTGA
TTTTGGAGTTAGTAAGATCTTAGTACGATCATTAGATTCGTGTAATTCGTATGTTGGTACTTGTGCTTATATGAGTCCGG
AGAGGTTTGATTCAGAATCTTCCGGTGGAAGTTCCGATATCTACGCCGGAGATATCTGGAGTTTTGGATTGATGATGCTT
GAGCTACTCGTTGGTCATTTTCCGTTACTTCCGCCGGGACAGAGACCTGATTGGGCCACGCTAATGTGCGCGGTGTGTTT
TGGAGAACCGCCGCGAGCGCCGGAGGGATGTTCTGAAGAGTTTAGGAGCTTCGTTGAGTGTTGTCTACGTAAAGATTCGA
GTAAGCGATGGACGGCGTCGCAGCTTCTTGCTCATCCTTTTCTCCGGGAAGATCTCTGA