Details for Lyrate rockcress Locus 16062258

Position : sca3 ( 5`- 5085522 .. 5087412 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_478632 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16062258

Protein [Map View]
MQRIKTSLSCLCLITTLLLLTAADSTEDTAVRLKLAHRDTLWPNPLSRIEDIIGADQKRHSLISRKRKFKGGVKMDLGSG
IDYGTAQYFTEVRVGTPAKKFRVVVDTGSELTWVNCRYRGRGKGKVKNRRVFRAEESKSFKTVGCFTQTCKVDLMNLFSL
STCPTPSTPCSYDYRYADGSAAQGVFAKETITVGLTNGRKARLRGLLVGCSSSFSGQSFQGADGVLGLAFSDFSFTSTAT
SLFGAKLSYCLVDHLSNKNISNYLIFGYSSSSTSTKTAPGRTTPLDLTLIPPFYAINIIGISIGDDMLDIPTQVWDATTG
GGTILDSGTSLTLLAEAAYKPVVTGLARYLVELKRVKPEGIPIEYCFSSTSGFNESKLPQLTFHLKGGARFEPHRKSYLV
DAAPGVKCLGFMSAGTPATNVVGNIMQQNYLWEFDLMASTLSFAPSTCT*

DNA
ATGCAGAGAATCAAGACATCGCTCTCGTGTCTCTGTCTCATCACGACGCTCCTCCTACTCACCGCCGCAGATTCCACGGA
AGACACGGCGGTGCGGCTAAAATTAGCACACCGGGACACTCTCTGGCCGAATCCTCTCAGCCGCATTGAGGACATTATCG
GTGCCGACCAGAAGCGTCATAGTTTGATATCTAGGAAACGTAAGTTCAAAGGAGGAGTGAAAATGGATTTGGGATCAGGG
ATTGATTACGGAACGGCGCAGTATTTCACGGAGGTTAGAGTTGGAACTCCGGCGAAGAAGTTTAGAGTGGTGGTTGATAC
AGGAAGCGAGCTTACTTGGGTGAATTGTAGATACCGTGGGAGAGGCAAAGGTAAAGTTAAGAATCGGAGAGTGTTTAGAG
CTGAAGAATCTAAAAGTTTTAAAACTGTTGGATGCTTTACTCAGACTTGTAAAGTTGATTTGATGAATCTTTTCTCACTC
TCTACTTGTCCTACTCCTTCCACTCCTTGCTCCTATGATTACAGATATGCGGATGGGTCAGCAGCACAAGGCGTATTCGC
AAAGGAGACTATCACAGTTGGTCTCACAAATGGTCGTAAGGCTAGACTCCGCGGTCTCCTCGTTGGTTGTAGTAGTTCAT
TTAGTGGACAGAGCTTTCAAGGAGCCGATGGGGTTCTTGGTTTAGCCTTTAGCGATTTCTCTTTCACTTCCACAGCCACT
AGTCTCTTCGGTGCGAAATTGTCCTACTGCCTCGTTGATCACCTCTCCAACAAAAACATCTCCAACTATCTCATTTTCGG
TTATTCCTCCTCCTCCACCTCCACCAAAACCGCCCCCGGACGAACCACCCCGCTTGATCTCACTCTCATCCCACCCTTCT
ACGCAATCAACATCATTGGAATCTCCATCGGAGACGACATGCTAGATATCCCCACTCAAGTATGGGACGCAACTACCGGT
GGTGGGACTATCTTGGACTCAGGAACTAGCCTCACGCTATTGGCTGAAGCCGCGTACAAACCGGTGGTTACAGGGCTCGC
ACGTTACCTTGTTGAGTTGAAAAGAGTCAAGCCAGAAGGAATACCAATTGAGTACTGTTTTAGTTCCACGTCCGGGTTCA
ACGAGAGCAAGTTACCGCAGCTGACGTTTCATTTAAAAGGCGGTGCACGATTTGAGCCGCATCGTAAAAGTTACCTAGTA
GATGCAGCGCCTGGAGTCAAGTGTTTAGGATTTATGTCAGCGGGAACGCCGGCGACTAATGTGGTCGGGAATATAATGCA
GCAGAATTATTTGTGGGAGTTTGATCTTATGGCCTCAACTTTGTCTTTTGCTCCTTCTACTTGCACTTAG