Details for Lyrate rockcress Locus 16062250

Position : sca3 ( 5`- 8495630 .. 8493541 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_318717 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16062250

Protein [Map View]
MKLKSVFDASEIKSEFESAGINPNFAIPIWKYVIQNPDCVWDEIPSLPSAAYSLLHSKFKTLTSSLHSLFHSSDGTTSKL
LIKLQNGAFVEAVVMRYDTRLGMLGGKPRPGGIRSTLCISSQVGCKMGCTFCATGTMGFKSNLTSGEIVEQLVHASRIAD
IRNIVFMLLPWFDDCDQGMGEPLNNYNAVVEAVRVMLKQPFQLSPKRITISTVGIVHAINKLDNDLPGVSLAVSLHAPVQ
EIRCQIMPAARAFPLQKLMDALQTFQKNSQQKIFIEYIMLDGVNDQEQHAHLLGELLKTFQVVINLIPFNPIGSTSQFET
SSIQSVSSFQKILRETYKIRTTIRKEMGQDISGACGQLVVNQPDIKKTPGTVELRDIEDLHL*

DNA
ATGAAGTTGAAATCGGTGTTCGACGCTTCGGAAATCAAATCGGAATTTGAATCAGCGGGAATAAACCCTAATTTCGCGAT
TCCAATCTGGAAATATGTAATTCAGAATCCTGATTGTGTATGGGATGAGATTCCTTCATTGCCTTCTGCTGCTTACTCTC
TTCTCCATTCCAAGTTCAAGACTCTTACTTCGTCTCTTCACTCGCTATTCCATTCCTCCGATGGCACAACCTCTAAACTC
CTCATCAAGCTCCAGAATGGAGCTTTTGTGGAAGCTGTGGTGATGCGATACGATACTCGGTTAGGGATGTTAGGAGGGAA
ACCACGTCCTGGAGGTATAAGATCTACATTATGTATTTCATCTCAGGTTGGTTGTAAGATGGGTTGCACATTCTGTGCTA
CTGGTACCATGGGATTTAAAAGCAATTTAACATCTGGAGAAATTGTGGAGCAGCTTGTTCACGCCTCTCGCATAGCTGAT
ATACGCAACATCGTTTTCATGTTGTTGCCTTGGTTTGATGATTGTGATCAGGGAATGGGAGAACCTTTAAATAACTACAA
TGCTGTTGTTGAAGCTGTCCGCGTCATGTTAAAACAGCCATTTCAGCTGTCACCCAAAAGAATTACCATATCAACTGTCG
GAATTGTTCACGCAATTAACAAGCTAGACAATGATCTACCCGGTGTAAGTTTAGCAGTATCTCTTCATGCACCAGTTCAA
GAAATCCGCTGCCAGATCATGCCAGCAGCTAGAGCCTTTCCTCTTCAAAAGCTTATGGATGCACTTCAAACTTTCCAAAA
GAACAGTCAACAAAAGATCTTCATTGAGTACATAATGCTTGATGGAGTAAATGATCAAGAGCAGCACGCTCATCTACTTG
GCGAATTGCTAAAGACATTTCAAGTGGTCATAAATTTGATACCATTTAATCCAATTGGATCCACAAGCCAATTCGAAACA
AGCAGCATACAAAGCGTATCAAGTTTCCAGAAAATCCTGAGGGAAACATACAAGATCCGAACCACAATTCGCAAAGAAAT
GGGTCAGGATATTAGCGGCGCTTGCGGTCAGCTAGTCGTGAACCAACCAGACATCAAAAAGACTCCTGGAACTGTGGAAC
TTAGAGACATTGAAGATCTGCATCTCTAA