Details for Lyrate rockcress Locus 16062212

Position : sca3 ( 5`- 4332114 .. 4330462 -3` )
Annotation : [B2G] nucleic acid binding protein
External links : CoGe
PGDD synteny : 16062212

Protein [Map View]
MAAMTEKEAMVDPFLVEALQNPRHRLTILRMELDIQKFFQNPEQLQFEFRPFPTSYLRLAAHRVAQHYGLVTMALDNGTG
AGDGSENRILVTKTAESRFPYVCLSEIPVKQPENGRPEGFKIAIKPRPKRGSGCGGSGSGVQQNLLRSVEERKEEYDKAR
ARIFNSPSSSDSEDSSSLRPPPLEVKNTCINRNETEVAVNNDPVDAVTRDSGRTSRVAIIRDREKDRYDPDYDRSYDRYV
VDPAYRYVRVMPSGQSFSPIPIHIPFHDGVFPQMPRGHQANLNYGHPLNPALSPFTHNAASYTPWPNSPAMNYAQPLNGS
DTNLFRHPSASNP*

DNA
ATGGCTGCTATGACAGAGAAGGAAGCTATGGTGGATCCTTTTCTGGTCGAAGCTCTTCAGAATCCTCGTCATCGTCTCAC
CATTTTGCGGATGGAGCTTGATATACAGAAGTTCTTTCAAAACCCTGAGCAGCTTCAGTTCGAATTCCGGCCTTTTCCAA
CATCGTACCTGCGTCTTGCTGCACATCGAGTTGCTCAGCATTATGGACTAGTAACCATGGCTTTGGACAATGGTACTGGT
GCTGGTGATGGATCCGAGAACAGAATCCTGGTGACTAAGACAGCGGAGAGTAGATTTCCTTATGTCTGCTTATCCGAAAT
CCCTGTGAAACAACCTGAGAATGGTAGACCCGAGGGTTTCAAAATCGCTATCAAGCCTAGACCCAAGAGAGGATCTGGTT
GTGGGGGTAGCGGATCGGGAGTACAACAGAATCTTTTGAGAAGTGTTGAGGAGAGAAAGGAAGAGTATGATAAAGCCCGG
GCTCGGATCTTTAACAGCCCTAGCAGCTCCGACTCTGAAGATTCTTCATCACTACGACCTCCCCCTCTTGAAGTGAAAAA
CACATGTATAAACCGGAATGAGACTGAAGTGGCGGTTAATAATGATCCTGTTGATGCTGTTACTCGAGACTCTGGACGGA
CTTCTCGAGTAGCCATTATCAGAGATAGAGAGAAAGATCGATATGACCCGGATTATGATAGGAGCTATGACAGGTATGTC
GTAGATCCCGCCTACAGGTACGTCAGGGTTATGCCGTCTGGCCAAAGCTTCAGTCCAATACCAATCCACATTCCGTTTCA
CGATGGGGTTTTCCCGCAGATGCCAAGAGGTCATCAAGCCAACCTAAACTATGGGCATCCGCTTAACCCTGCTTTGAGTC
CCTTTACTCATAACGCGGCTTCATATACACCGTGGCCAAACTCACCTGCTATGAACTATGCACAGCCGTTGAACGGCTCA
GACACAAATCTTTTCAGGCATCCTTCTGCAAGTAATCCCTGA