Details for Lyrate rockcress Locus 16062194

Position : sca3 ( 5`- 12413266 .. 12415068 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_480015 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16062194

Protein [Map View]
MVRIQKVESFYAKLRESATSLSSQNPLLIFPSTSDVDSLCALKVITHILESDSIQYSCFPVSSFLEIHKYAGPAGLCSTS
SESPPVTILLINWGCHRDLKLVLKLGPAARVFVVDSHRPIHLHNLSDYNEQVVVLHTDDDERQADLAYDFDVLKLANESF
QLHVEEGGESDEEEEEEEDEEEEDEDDDDDDGDGDRPSKRRKMGDGVKVFKKLKRDYYKMGTFHGKPSGCLLFELSHMLR
KNTNELLWLACVALTDQFVHERLTDERYQAAVMELEQHINSSGNIDKITSVTLKDGTKVRAPDCSRISYEEEPRLMLLRE
WTLFDSMLCSSYIATKLKTWSDNGIKKLKLLLARMGFALIECQQKFPYMSHEVKRKMKQEFDRFLPEYGLNDFYYRSFLR
LHGYSSRVSAADVVYGITALLESFLGSGGSSASKQFGEAYDALSLNNLDKLRSGMQQAIKVQRAILRQGSAAITKTGCIR
SGRKFRWVKIEDSMDAKYLGYPQALTKFCYFLMDALREKGARMKPMLCACASQQPGKLLVVGVCGKPRLGAVRGNAFGNA
FRKAAQESRADYFHELFESSWIVLDASAVNSFMIRLTEKL*

DNA
ATGGTGAGGATTCAGAAAGTAGAATCGTTCTACGCGAAGCTTCGTGAGTCAGCTACTTCATTATCTTCACAGAATCCACT
TTTGATATTTCCTTCAACATCTGATGTTGATTCACTTTGTGCGCTTAAGGTTATTACTCATATCCTCGAATCAGATTCGA
TTCAGTATTCTTGTTTCCCTGTATCGTCTTTTTTGGAGATTCACAAGTATGCTGGTCCTGCTGGTTTGTGTTCTACTTCG
TCTGAGTCTCCTCCTGTTACTATACTGTTGATTAATTGGGGTTGTCACCGTGATTTGAAGCTCGTGTTGAAGTTAGGTCC
CGCGGCTCGTGTTTTTGTTGTTGATAGTCATAGGCCTATTCATTTGCATAATCTTAGTGATTATAATGAGCAAGTTGTTG
TTCTTCATACTGATGATGATGAGAGACAAGCTGATTTGGCTTATGATTTCGATGTGTTGAAATTGGCGAACGAGAGCTTT
CAGTTACATGTAGAAGAAGGGGGTGAATCTGATGAGGAGGAGGAGGAGGAAGAAGATGAGGAAGAGGAAGATGAGGATGA
TGATGATGATGATGGAGATGGTGATAGGCCAAGTAAGAGGAGAAAAATGGGAGATGGTGTGAAGGTTTTCAAGAAGTTAA
AGAGGGATTATTACAAGATGGGGACTTTTCATGGGAAGCCATCGGGATGTTTGTTGTTTGAGCTATCTCATATGTTGAGG
AAGAACACAAATGAGTTGCTGTGGCTGGCTTGTGTTGCTTTGACTGATCAGTTTGTTCATGAGAGGTTGACTGATGAAAG
ATACCAAGCTGCGGTTATGGAGCTTGAACAACACATCAATAGCTCAGGGAATATAGATAAGATCACTTCTGTTACTTTGA
AAGATGGAACCAAGGTTCGAGCACCTGACTGTTCGAGAATCTCTTATGAAGAAGAGCCTAGGCTTATGCTTCTCAGGGAG
TGGACGTTGTTTGACTCTATGCTTTGTTCTTCATACATTGCGACTAAGTTGAAGACATGGAGCGATAACGGCATCAAGAA
ACTTAAGCTTCTTCTAGCACGTATGGGATTTGCGCTTATCGAGTGCCAGCAAAAGTTTCCATACATGAGCCATGAGGTGA
AAAGGAAAATGAAGCAAGAGTTTGATCGGTTTTTGCCAGAATATGGGCTTAATGATTTCTACTACCGGAGTTTCTTGAGG
CTTCATGGTTATAGCTCAAGGGTCTCTGCTGCAGATGTTGTGTATGGTATTACAGCACTTCTTGAATCATTTCTTGGATC
AGGTGGCTCCTCTGCTTCAAAACAGTTTGGCGAAGCTTATGATGCTCTGTCTTTGAACAATTTGGATAAACTTCGGTCTG
GGATGCAACAAGCAATCAAGGTTCAACGAGCAATTCTTAGACAAGGAAGTGCAGCAATCACCAAAACTGGATGCATCCGA
AGTGGTAGGAAATTCAGATGGGTAAAGATTGAAGATTCCATGGATGCTAAGTATTTGGGATATCCTCAGGCCTTAACAAA
ATTTTGTTACTTTCTAATGGATGCTTTGAGAGAGAAAGGAGCTAGGATGAAACCGATGCTTTGTGCCTGTGCATCTCAAC
AACCTGGGAAGTTACTCGTGGTTGGAGTTTGTGGGAAACCGAGGCTCGGGGCAGTCAGAGGGAACGCTTTTGGCAATGCT
TTCAGAAAGGCAGCTCAAGAAAGTAGAGCTGATTACTTTCACGAGCTTTTCGAGTCTTCATGGATTGTCTTGGATGCTTC
TGCAGTTAACTCTTTCATGATTAGATTAACTGAGAAGCTCTGA