Details for Lyrate rockcress Locus 16062187

Position : sca3 ( 5`- 22291647 .. 22292816 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16062187

Protein [Map View]
MTIMSDLPRDLLAEILSKVPLTSLRAVRFTCKKWNDLSKDRSFHKKQIIEAKKKQLKEFEVIMMRNFRVYLTSVDIHSDV
DPSFTPKGTLISLNDDANHHQVDNVSKVFHCDGLLLCITKDLNFRLVVWNPYFGQIRWIKPRNSYHILDSYAFGYDENKN
HKILRFKDNYYTFSAQDQICEFEVYSFESNSWKVVLDVSPACDIEAYNRGLSLKGNTYWYAKDKYDRGGEDIDFLICFDF
TSERFGPRLPLPFNSSPTWEDIVTLSSVGEDQLAVLFQSNRTKWMEIWITSKIEPTEVSWNKLFLAVDMRALTRFEFLAH
AGSFFIDQKKNVVVVFDRDMDAPTDRGMAYIIGKNGYFRKVDLGEDADSSCYPLVCSYVPSSVQIRQLT*

DNA
ATGACGATAATGTCAGATCTTCCACGGGATTTGTTAGCGGAGATTCTCAGTAAGGTTCCGTTGACATCTCTAAGAGCAGT
GCGGTTCACTTGCAAAAAATGGAACGATTTATCCAAAGATCGGAGCTTTCACAAGAAGCAAATCATCGAAGCAAAGAAGA
AGCAATTGAAAGAGTTTGAGGTGATCATGATGAGGAATTTTAGGGTTTATCTGACGAGTGTCGATATCCACAGCGATGTT
GATCCATCTTTTACGCCTAAAGGTACACTTATTAGCTTAAACGATGATGCAAATCATCATCAAGTCGATAATGTATCTAA
GGTCTTTCACTGCGATGGCTTACTCTTATGCATCACCAAAGACCTTAACTTTAGGCTTGTGGTTTGGAATCCTTATTTTG
GGCAAATAAGATGGATCAAACCCAGAAATTCTTATCACATTTTGGATAGTTACGCTTTTGGGTACGACGAGAATAAGAAC
CACAAAATCTTGAGATTTAAGGATAATTATTACACTTTTAGTGCACAGGATCAGATTTGTGAGTTTGAAGTCTATAGTTT
TGAGTCTAATTCATGGAAGGTTGTTCTTGATGTGAGTCCTGCCTGCGATATAGAGGCTTATAACCGTGGATTGTCTCTTA
AGGGGAATACTTACTGGTATGCTAAAGATAAGTATGACAGAGGAGGAGAGGATATTGATTTCTTGATATGTTTTGATTTC
ACATCAGAGAGATTTGGACCGCGTCTGCCTCTGCCTTTTAACTCTTCTCCTACTTGGGAAGATATTGTTACTCTCTCTAG
TGTTGGAGAAGATCAGCTTGCGGTGTTGTTTCAGAGCAATCGTACAAAGTGGATGGAGATTTGGATTACGAGCAAGATTG
AGCCTACAGAGGTTTCATGGAACAAGTTGTTCTTAGCGGTTGATATGAGAGCACTCACTCGTTTTGAGTTCCTGGCCCAT
GCTGGGAGTTTCTTCATTGACCAGAAGAAGAATGTTGTTGTGGTTTTTGATAGAGATATGGATGCCCCTACCGATCGTGG
CATGGCTTACATTATTGGGAAGAATGGATACTTCAGAAAAGTGGATCTTGGGGAAGATGCAGACTCGAGTTGTTACCCAC
TTGTCTGTTCTTATGTTCCAAGCTCAGTGCAAATCAGGCAGCTAACCTGA