Details for Lyrate rockcress Locus 16062180

Position : sca3 ( 5`- 8975293 .. 8973017 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16062180

Protein [Map View]
MDSIEPPSFSLGFDLDAASDPHQNPSSTGDQLIGDGDNEPEAGLTVSDSDRELEPDFRSPVLKRLRRGINPNKCSWKDDR
GVAIEDRDDDIEEFSSPEDFPTGRLEWVWSLHADNLLFTRTLIKRHSTQTDAPASARSHFSSCSSRVPLHGSGVLSNQPS
ISRGKRKQSDVPASAASGISSVASLFQRSSRSPLRRFQLLDSDSEDDHPSTSRDLSRVTKKHDSSSKDQPSIAIKPKRKE
PGSIPSIKDLWKDFSPAISKIQTPALDDVCQDYFSSIKTTSTAQKQSSAAASSSNSGNHNLTGFQQTGQFLDFSHPSPPS
HRFFLHSDPRIRNLARQRLPNFLPLGIVNDRESQREVFLVDYMNQFGSKGSSKTGDSSSKSCRRGQTKSKFSKGQESAHN
SEGWLNPKTRAAAPKDAGKRRVSANSGSAGHWFTSPEGRKVYISKSGQEFSGQSAYRCYRKENGGGFKKSRKKRQPKKKA
KN*

DNA
ATGGATTCAATTGAGCCACCATCGTTTTCGCTAGGGTTTGATCTTGATGCTGCATCGGATCCACATCAGAACCCTAGCTC
CACCGGCGACCAATTAATCGGGGACGGCGATAACGAGCCAGAGGCGGGACTTACGGTCTCAGATTCCGATCGGGAGCTTG
AACCAGATTTTAGAAGCCCGGTTCTCAAGCGGTTGCGACGGGGAATTAATCCCAACAAGTGTTCTTGGAAAGATGATAGA
GGCGTGGCTATAGAGGACCGGGATGATGACATTGAAGAGTTCTCTTCTCCAGAGGATTTTCCCACGGGTAGACTAGAATG
GGTTTGGAGCCTTCACGCTGACAATTTGTTATTTACAAGGACACTGATTAAGCGTCATTCCACTCAAACTGATGCACCTG
CCTCAGCGAGAAGTCATTTTTCTAGTTGCAGCTCAAGGGTGCCACTTCATGGTTCTGGGGTTTTATCTAATCAACCTTCT
ATCTCTCGCGGAAAAAGAAAGCAGTCGGATGTTCCAGCATCTGCTGCCTCTGGGATTAGTTCTGTTGCATCATTGTTTCA
GAGGTCAAGTCGTAGTCCTCTGCGAAGGTTCCAGCTACTAGATTCAGATTCGGAAGATGACCATCCATCCACCAGCAGAG
ATTTAAGCAGAGTAACTAAAAAACATGATTCATCCTCAAAGGATCAACCATCTATTGCAATTAAACCAAAGAGAAAGGAA
CCTGGATCTATTCCAAGTATTAAGGATTTGTGGAAAGATTTTTCCCCGGCAATTTCCAAGATTCAAACACCAGCTTTGGA
TGATGTTTGTCAGGACTATTTTAGCTCCATCAAGACGACTAGCACAGCTCAGAAACAAAGCAGTGCTGCGGCAAGTAGTA
GCAATAGCGGAAATCATAACTTGACTGGCTTTCAGCAAACTGGGCAATTCTTGGATTTTTCTCACCCTTCTCCTCCATCT
CATCGTTTCTTCTTGCATAGTGATCCAAGGATCCGGAATCTAGCTCGACAGCGGTTACCAAACTTCTTGCCTCTGGGAAT
TGTCAATGATAGGGAGAGCCAGCGAGAGGTGTTCCTTGTTGATTATATGAATCAATTTGGCAGCAAAGGGAGTTCTAAAA
CTGGAGACTCTAGCAGCAAAAGCTGCAGAAGAGGGCAAACAAAGTCAAAGTTTTCAAAAGGACAAGAGAGCGCACACAAT
TCTGAAGGCTGGTTAAATCCTAAAACGAGAGCTGCAGCTCCAAAGGATGCTGGCAAAAGGCGTGTATCAGCTAACAGTGG
CTCTGCAGGTCATTGGTTCACATCCCCAGAAGGAAGGAAGGTATATATCTCTAAAAGCGGACAGGAGTTTTCAGGTCAAA
GTGCTTATAGATGTTACAGAAAGGAGAACGGAGGTGGGTTTAAGAAGTCTAGAAAGAAACGACAGCCAAAGAAGAAGGCG
AAGAATTGA