Details for Lyrate rockcress Locus 16062173

Position : sca3 ( 5`- 7483719 .. 7484899 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16062173

Protein [Map View]
MMISDLPHDLESEILYRVPAKSLAKWKTTCKRWYALFRDPRFVKKNFGKAATREMIVLMNLRLYSNSVNLQGINHRVDPA
MEVTGKLIKLNDSEAVDISNIFYCDDLWFGIPVPVKLDVSNPRKCYQNNDRYALGYGSSTSCHSYKILRSCIYYNDQNLM
DAEFEIYDFSTNSWRDLGYITRDLVVFSISGNKDNGFFLQYFDFKTERFGRLPLPYQSFNAEDTAALSVVGDEKLVVLHQ
SILAFSDEMRIWVTNKIDEAKDLSWRERLPLNSGLCFLLEEENEVAVCSDVDMKDGRRSRIYIVGKDIYIYKEVYKESTK
GSDINWPLLLSYVPSLVNIQKNISKKAEENEIKRMLVE*

DNA
ATGATGATTTCCGATCTTCCACACGATTTGGAATCGGAAATACTTTATAGGGTTCCGGCGAAGTCTCTAGCAAAATGGAA
GACTACTTGCAAACGATGGTACGCTTTATTCAGAGATCCGAGATTCGTCAAGAAGAACTTTGGTAAAGCAGCAACAAGGG
AAATGATCGTACTGATGAATTTGAGGCTTTATTCAAACAGCGTCAATCTCCAAGGGATTAACCACAGAGTTGATCCAGCT
ATGGAGGTTACAGGTAAACTCATCAAGCTAAATGATTCAGAAGCTGTTGACATTTCTAATATCTTTTACTGCGACGACTT
GTGGTTTGGAATCCCTGTACCTGTGAAACTAGATGTATCTAACCCCAGAAAATGTTACCAGAATAATGATAGGTATGCTC
TTGGATACGGAAGCAGCACATCTTGCCATAGCTACAAAATCTTGAGGTCGTGCATTTATTACAACGACCAAAACCTCATG
GATGCTGAGTTTGAGATCTATGACTTTAGCACTAATTCTTGGAGAGATCTTGGTTACATCACTCGTGACTTGGTCGTATT
TTCCATTTCTGGAAATAAAGATAATGGCTTTTTCTTGCAGTATTTTGATTTCAAGACAGAGAGATTTGGGCGTCTCCCTC
TTCCATACCAGAGTTTTAATGCTGAAGATACCGCCGCTCTATCAGTCGTTGGGGACGAAAAGCTTGTGGTGTTACACCAG
AGTATTCTTGCATTTTCAGATGAGATGAGGATTTGGGTCACAAATAAGATTGATGAGGCCAAAGACTTGTCGTGGAGGGA
GCGACTTCCTCTGAACAGTGGATTATGCTTCTTGTTGGAAGAGGAGAATGAAGTGGCAGTGTGTTCTGACGTAGACATGA
AAGATGGACGTAGGAGCAGAATCTACATTGTTGGAAAGGATATATATATATATAAAGAAGTTTATAAAGAAAGTACAAAG
GGATCAGATATCAATTGGCCACTTCTCCTCAGTTATGTTCCAAGCTTGGTTAACATTCAGAAAAATATATCCAAAAAGGC
AGAAGAAAATGAAATCAAAAGGATGTTAGTGGAATGA