Details for Lyrate rockcress Locus 16062162

Position : sca3 ( 5`- 5688460 .. 5689704 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16062162

Protein [Map View]
MPTMPNLPLEVLEEKILSRAPVTFLRAMRSTCKKWNNFSKEKIIPEAARKQQGLMLIKNNICSLSFSFQGIHKDDFVVPS
INQVNIPDHIKVDKIFHCDGILLCVIEKNSSLVVWNPYLGQTRRIKVSNDPDRNEKYRKCDMYALGYDNNNRNHKILRIM
KDFRHSDGLGYEIYRFASNSWSLLDEEVMKPDWNVWSAQRSSVSLKGNTYFFLQGNDYGNEEDEDAEEYEDDDIVPKDNF
LLCFDYTTESFGPRLLLPFNPHVEETVALSCVGKERLAMLYQSSKTSESIEIWVTDKIDPKAVSWSKFLKVDITPLTGFP
VDIYADSFFIDEEKKVAAVVDVHYCYQKAHIIGEDGYLKCVNMGRAPDVGNGQPLVFSSYVPSLVKVPIKQPKGKRKGRD
LIKPKAKRTKKEER*

DNA
ATGCCGACGATGCCTAATCTTCCGCTAGAGGTTTTGGAAGAGAAGATTCTCTCTAGGGCTCCGGTTACATTTCTGAGGGC
AATGCGATCTACTTGCAAAAAGTGGAACAATTTCTCAAAAGAGAAGATTATTCCCGAAGCTGCAAGGAAGCAGCAAGGTT
TAATGTTGATCAAAAACAACATCTGTTCCTTGAGTTTCAGTTTCCAAGGAATCCACAAGGATGACTTTGTCGTTCCGTCG
ATAAATCAGGTAAATATTCCTGACCACATCAAGGTAGATAAAATCTTTCACTGTGACGGCATATTATTATGTGTTATAGA
GAAAAACTCTAGCCTTGTAGTATGGAATCCCTATTTAGGGCAAACGAGGAGAATCAAAGTCAGTAATGATCCCGACAGGA
ATGAAAAGTATAGGAAATGTGATATGTATGCTCTTGGTTACGACAACAACAACCGTAACCACAAAATCTTGAGGATTATG
AAAGATTTTAGGCACAGTGACGGTTTAGGATACGAAATCTACAGATTCGCATCAAATTCATGGAGTTTGCTTGATGAGGA
AGTGATGAAACCCGACTGGAATGTATGGTCTGCTCAACGAAGCTCCGTGTCTTTGAAGGGAAATACTTATTTCTTTCTTC
AAGGGAATGATTATGGGAATGAAGAGGACGAAGATGCCGAAGAGTACGAAGATGACGACATAGTGCCGAAAGATAATTTT
TTGCTCTGTTTCGATTATACAACAGAGAGCTTTGGTCCGCGTCTACTTCTACCGTTTAACCCTCATGTTGAAGAGACCGT
GGCTTTATCATGTGTTGGAAAAGAGCGGCTCGCTATGCTATATCAAAGCTCCAAGACATCTGAGTCGATAGAGATATGGG
TAACAGATAAGATTGATCCAAAAGCGGTGTCGTGGAGCAAGTTTCTGAAAGTGGATATCACACCACTCACTGGTTTTCCG
GTTGACATTTACGCTGATAGTTTCTTCATTGACGAGGAGAAGAAAGTTGCTGCGGTTGTCGATGTACATTATTGCTACCA
AAAAGCTCACATCATTGGAGAAGATGGATACCTGAAATGTGTGAATATGGGAAGAGCTCCGGATGTTGGAAATGGTCAGC
CACTTGTGTTCTCTTCTTATGTTCCAAGTTTGGTGAAAGTGCCTATCAAGCAACCAAAGGGTAAAAGAAAAGGTAGAGAT
CTAATAAAACCAAAAGCAAAACGAACAAAAAAGGAAGAAAGATAA